(data stored in ACNUC7421 zone)

EMBL: CP002355.PE14

CP002355.PE14        Location/Qualifiers
FT   CDS_pept        15410..16777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0014"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1882 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32682"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW66"
FT                   /protein_id="ADR32682.1"
FT                   /translation="MKKVALSALAAVVISGVASADALTLYSDPKTGQVYTTPGEGRVEM
FT                   GDFVSAKEVDMQMRDLESKGSEYQDKMSKYVNVKSKAKTLEFSGTHYFGLTSASPSTTV
FT                   SDADGSHTSKYAGTSTGFELRRNYVQVKAYFNDKDYFRVTMDTTKELASSTSYANIYAK
FT                   YAYLYLDKVLPYTGVEIGIAHRPWIDYEEHNAWHYRSFNKVVLEEKGTATETGVDLVNS
FT                   ADLGVNFKTQTDAFSSEIGIFNGEGYHADKAAANQENDSKLSLEWRLTGHILGSGTKVG
FT                   KNDRTKDTYANISTYGLISKNHKDDDVDLQGVDSPNEYDRSIYGIHAVYNQPEFLIAAQ
FT                   YFTAKDDKRTQNIATGFDTKDYKGWSVNAEYRPFQDWTVIGRYDNYSIESELNGVDVND
FT                   IEGDKIIAGLAYKYNKNVSFIASAKFADEKDKKVAAKSSDTGESKDVYMLTTEVKW"
     atgaaaaaag ttgcattatc tgcccttgct gcggtagtga ttagcggtgt tgcatcagcc        60
     gatgcattga ctctttacag tgatccgaaa acaggacagg tttacacaac tcctggtgaa       120
     gggcgtgttg aaatgggcga tttcgtcagc gcaaaagaag ttgacatgca aatgcgcgat       180
     ttggaatcaa aaggttctga ataccaagac aaaatgtcta aatacgtaaa cgtaaaatct       240
     aaagctaaaa cacttgagtt cagcggtact cactatttcg gtttgacatc ggcaagcccg       300
     tctacaacag tttcagatgc ggatggatca catactagta aatatgcagg gacatcgacc       360
     ggatttgaat tgcgccgtaa ctatgtgcaa gtaaaagcct atttcaatga taaagattat       420
     ttccgcgtaa caatggatac gacaaaagaa cttgcatctt caacaagcta tgcaaatatc       480
     tatgcgaaat atgcttattt gtatcttgac aaagtacttc cgtataccgg tgttgagatc       540
     ggtattgcgc accgtccgtg gatcgattac gaagagcaca atgcatggca ttaccgttct       600
     ttcaataaag tagtattgga agaaaaaggg actgctacgg aaactggtgt tgaccttgtt       660
     aactctgctg acttgggtgt gaatttcaaa acccaaacag atgctttcag ctctgaaatc       720
     ggtattttca acggtgaagg ttaccatgcc gacaaagcgg ctgctaacca agaaaacgat       780
     tcaaaacttt cacttgaatg gcgtttgacg ggacacatcc tcggcagcgg tacaaaagtg       840
     ggtaaaaacg accgtactaa agatacgtat gccaatatct ctacatacgg tttgatctct       900
     aaaaaccata aagacgatga cgtcgatttg caaggtgtgg acagcccgaa tgaatacgac       960
     cgctctattt acggaatcca tgcggtttat aaccaaccgg aattcctgat cgcggcacag      1020
     tattttacgg caaaagatga caaacgtaca caaaatattg ctacaggatt tgatacgaaa      1080
     gattacaaag gttggtcggt caatgccgaa taccgccctt tccaagattg gactgttatc      1140
     ggacgttatg acaattacag cattgaaagc gaattaaacg gagtcgatgt caatgatatc      1200
     gaaggtgata aaatcattgc cggtttggca tacaaataca ataaaaacgt aagttttatc      1260
     gcttcagcta aattcgctga tgaaaaagat aaaaaggttg ccgcgaaatc ttcagatacc      1320
     ggcgaatcta aagacgttta tatgttgacg accgaagtta aatggtaa                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page