(data stored in ACNUC7421 zone)

EMBL: CP002355.PE140

CP002355.PE140       Location/Qualifiers
FT   CDS_pept        141080..142258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0141"
FT                   /product="Recombination protein MgsA"
FT                   /note="COGs: COG2256 ATPase related to the helicase subunit
FT                   of the Holliday junction resolvase; InterPro IPR003959:
FT                   IPR003593; KEGG: tdn:Suden_0211 recombination factor
FT                   protein RarA; PFAM: AAA ATPase central domain protein;
FT                   SMART: AAA ATPase; SPTR: AAA ATPase; PFAM: MgsA AAA+ ATPase
FT                   C terminal; ATPase family associated with various cellular
FT                   activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32808"
FT                   /db_xref="GOA:E4TXB1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB1"
FT                   /protein_id="ADR32808.1"
FT                   /translation="MADLTYLLRPKKFDDVVGQPHLCSPDSPLRSLCENGNLTHSFFYG
FT                   PPGCGKTTLARIIAEVMGLPFYEFNATSLKIEQLRKIFDQYENSLTKPLIFIDEVHRLA
FT                   KNQQEVLLPVMEKNSVLVIGASTENPYFSLTAAMRSRSLLFELYSITHEALDDLLVRTA
FT                   IEMDEEAREYLIASSGGDARAMLKLLEVSCALNKPITLGLLKSLRPAAQSLGSSEAGVH
FT                   YDLASALIKSIRGSDPDAAIYYLARLIEGGEPPEFIARRLVILSSEDVGNANPQALTLT
FT                   TSAMMSVKQIGYPEARIILAQAVIYLCASPKSNTAYNAINSAQQAVKNGVILDIPTHLR
FT                   QQHKGYLYPHDFGGWVDQQYLSKPLKFVEFKNSGYEAKMGEWIQKVWNRSKV"
     atggccgatt tgacctatct gcttcgtccg aaaaaatttg acgatgtggt aggccagcct        60
     cacctttgtt ctcctgattc cccattgcgt tctctgtgtg agaacggtaa tcttacccac       120
     tctttttttt acggtcctcc cggctgtggc aagacgacat tggcgcggat tattgccgaa       180
     gtgatgggct tgccctttta cgaatttaat gccacatctc ttaaaatcga acagctccgc       240
     aaaattttcg atcaatatga aaattcactc accaagccgc ttattttcat cgatgaggta       300
     caccgtctag caaagaatca gcaggaagtg ttactcccgg ttatggaaaa aaacagcgtg       360
     ttagtgatcg gtgcatcgac ggaaaatccc tatttttcgc ttacggcagc gatgcgatcc       420
     cgttcgttgt tgtttgaact ctattcgatt acacatgaag cgttagacga tttgttagtt       480
     cgaacggcta ttgagatgga cgaagaggca cgcgaatatt tgattgccag ttcgggcggc       540
     gatgcgcgtg caatgctcaa acttctcgaa gtctcttgtg cactaaataa accgattaca       600
     ttgggactac tcaaatcgct ccgtcctgct gcacaaagtt tgggaagctc cgaagcggga       660
     gtccattacg atcttgcttc cgcactgatc aaaagtatcc ggggaagcga tcccgatgcg       720
     gcgatttatt atctcgcccg tcttatagaa gggggagaac cgccggaatt tatcgcccgc       780
     cgtctggtca ttctctcatc cgaagatgtg ggaaatgcca atcctcaggc gttgacgctg       840
     acgacctcgg cgatgatgag cgtaaagcag atcggctatc ccgaagcacg gattattttg       900
     gctcaagccg tgatctatct gtgtgcttcg cctaaatcca atacggccta caacgcgatc       960
     aattcggcac agcaagccgt caaaaacgga gtcattctgg acattcccac ccatttgcgc      1020
     caacagcata aagggtattt gtatccgcac gacttcggcg gttgggtaga tcagcaatac      1080
     ctatcgaaac cgctcaagtt tgtcgaattt aaaaacagcg ggtatgaagc gaagatgggg      1140
     gagtggattc aaaaagtgtg gaaccgttct aaagtataa                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page