(data stored in ACNUC7421 zone)

EMBL: CP002355.PE141

CP002355.PE141       Location/Qualifiers
FT   CDS_pept        complement(142387..145887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0142"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /note="COGs: COG1410 Methionine synthase I
FT                   cobalamin-binding domain; InterProIPR011822: IPR003726:
FT                   IPR000489: IPR004223: IPR 006158: IPR003759; KEGG:
FT                   sun:SUN_1818 5-methyltetrahydrofolate--homocysteine
FT                   methyltransferase; PFAM: homocysteine S-methyltransferase;
FT                   dihydropteroate synthase DHPS; Methionine synthase
FT                   B12-binding module cap domain protein; cobalamin
FT                   B12-binding domain protein; Vitamin B12 dependent
FT                   methionine synthase activation region; SPTR:
FT                   5-methyltetrahydrofolate--homocysteine methyltransferase;
FT                   TIGRFAM: methionine synthase; PFAM: Pterin binding enzyme;
FT                   Vitamin B12 dependent methionine synthase, activation
FT                   domain; B12 binding domain; Homocysteine
FT                   S-methyltransferase; TIGRFAM:
FT                   5-methyltetrahydrofolate--homocysteine methyltransferase;
FT                   methylmalonyl-CoA mutase C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32809"
FT                   /db_xref="GOA:E4TXB2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB2"
FT                   /protein_id="ADR32809.1"
FT                   /translation="MSVKNTLLETISRRPLIIDGAMGTQLQERADKIPESAWEGLEGCN
FT                   ELLNVTCPEVMSDIFHAYLTAGADLITTNTFGAFSWVLDEYGIGHRAYELSRAGAAVCK
FT                   AECDKFSTSDHPRYVLGSIGPGTKLPSLGHIHYDEMYEGYLECCLGLIDGGCDIFLLET
FT                   CQDPLQIKAALHACEAANKERTTALPIMVSVTIELAGSMLIGTDAATIATIMEPFDIIS
FT                   LGFNCGTGPEQYAKHVRTLSEVWGKPISVHANAGLPQNRGGYSYYPMGPDEFANLQRDF
FT                   LNYDGVSFLGGCCGTTPQHIRALVDKVSRVAPKKPSGETKPSIASLFNTVELIQTPAPL
FT                   LIGERSNSTGSKAFRELIIASDYEGTLSVGQAQVRDGAHCLDVNVEFAGRDGAVDMSHV
FT                   MRLYNQKIPLPLMPDATRVNTMEEALKCIGGKPIINSVNLEDGEERLDAICSLAKKFGT
FT                   ALVCLVIDEKGMAKTTEDKMRIADRIYDLCVNRHGIDPRNLMFDMLTFTVGSGDLEYRD
FT                   AAIQTLEAIRQLHFKYPNVGSTLGLSNISFGLSTNARVFLNSVFLHHCIEAGMTSVIIN
FT                   VKHIIPLSKMSEEDRAICEELLFHPDDQSLFKFIGHFSDKTIDNSKNDEAYEALSDEEK
FT                   IAKLLLDGDKERMIPLVERVRLTISPDKIVNEILIDAMKVVGELFGSGKMQLPFVLQSA
FT                   ETMKTTVDYLNPYLSKQEKDTDTTLVIGTVKGDVHDVGKNLVDIILSNNGFKVINIGIK
FT                   TELEEYLEVMKSKDIHAIGMSGLLVKSTQVMKDNLETMAGMGITTPVLLGGAALTRSFV
FT                   DDFCRPIYQGPIFYCRDAFDGVIAMSRIEKYNADPSIGLDTRLGGDMVEKSVKEVIDVV
FT                   IPPFHELKMPSREVKIPTPPFWGRRVLRKEQLDFDMVCEWINKRSLFKLHWGYKRAGMP
FT                   VDEYKKLLETKVYPAYERIKREIVKRGLFDPTIIYGYYPVRSSDQELLIFDESSGWNID
FT                   ENANRQPLDEVIGNAKYVFEFPRQRKVPHRALSDFFTHTRDDVLPLTCVSVGDKFSEYE
FT                   KELYAANEYLEYNLVHGFGVELAEALAEVAHKQIRLDLNIASDDEGFSLRDVRMNRYAG
FT                   ARYSFGYPACPDLEPSRIIFDLLRPEEFGITLSETFQIHPEQSTTALVVHHKEATYYNI
FT                   "
     atgtcggtaa aaaacacgct tcttgaaacc atttcccgcc gtccccttat tatcgacggc        60
     gccatgggaa cacagcttca agagcgtgcc gacaaaatcc ctgaaagtgc ctgggaagga       120
     ttagaagggt gcaacgagct tcttaatgtc acctgcccgg aggtcatgag cgatattttt       180
     cacgcctacc tcactgccgg agccgatctg attacgacca acaccttcgg cgctttcagc       240
     tgggtactcg atgaatacgg gatcggtcat cgcgcctacg agctctcccg tgcgggagcg       300
     gcagtctgta aagccgagtg tgataaattc tccacttccg atcacccccg ttatgtgctc       360
     ggttccatcg gaccgggaac caaactcccc tctttgggac atatccatta tgatgagatg       420
     tatgaggggt atctagagtg ctgtctcggt ctgattgacg gcggatgcga tatttttctt       480
     ttggagacct gccaggatcc actccagatc aaagcggctc tgcacgcctg cgaagcggcc       540
     aataaagaac gcactacggc tctgccgatt atggtctccg tcaccatcga gctagcggga       600
     agtatgctca tcggaaccga tgcggcaacg atcgcgacca taatggagcc gttcgatatc       660
     atcagcctgg gattcaactg cggtacggga ccggagcaat acgccaaaca cgtcagaacc       720
     ctctccgagg tatgggggaa accgatctcg gtgcatgcca atgcgggatt gccccaaaac       780
     cgtggcggct attcgtacta tccgatgggg cccgatgaat ttgccaatct tcaacgcgat       840
     tttttgaatt acgacggtgt cagcttcctc ggaggatgct gcggtacgac tcctcagcat       900
     attcgtgcac tggtcgataa agtctccagg gttgccccta aaaaaccgag cggagagacg       960
     aaaccgtcca tcgcatcgct gttcaataca gttgagctga tccagacccc tgctccgctc      1020
     ttgatcggag agcgctccaa ctcgacggga tcgaaagcgt ttcgcgaact catcatcgcg      1080
     agcgattatg aggggacact cagtgtcggt caagcgcagg tgcgcgacgg cgcccactgt      1140
     ttggacgtca acgtcgaatt tgcaggacgt gacggtgcgg tcgatatgtc tcacgtcatg      1200
     aggctctata accaaaaaat cccacttccc ctcatgcccg atgcgacacg ggtcaacacg      1260
     atggaagagg cactcaaatg tatcggcgga aaaccgatca ttaactcggt caacctcgaa      1320
     gacggagaag agcgtttaga cgctatctgt tctctcgcca aaaaattcgg aacggcgctt      1380
     gtatgtctcg ttatcgatga aaaagggatg gcgaaaacca ccgaggataa aatgcgtatc      1440
     gccgatcgta tttatgatct gtgcgtcaac cgccacggca tcgatccgcg caatctgatg      1500
     tttgatatgc tcacctttac ggtgggaagc ggagatttgg agtaccgtga tgccgccatc      1560
     caaacgctcg aagcgatccg gcagctccat ttcaaatatc cgaatgtcgg ctcaactctt      1620
     gggctttcta atatctcatt cggactcagt accaatgccc gtgtcttttt aaacagcgtc      1680
     tttttacacc attgtattga agcgggaatg acgagtgtca tcatcaacgt caaacacatc      1740
     ataccgctct ctaaaatgtc cgaagaggac cgtgccatct gtgaagagct tttattccat      1800
     ccggatgatc agtccctgtt taagtttatc ggacacttta gcgataaaac aatcgataac      1860
     tctaaaaacg atgaagccta tgaagcgctc agtgatgaag aaaagattgc caagctcctt      1920
     ctcgacgggg acaaagagcg aatgattccg ttggtcgaaa gagtccgcct cacaatcagt      1980
     cccgataaaa tcgtcaatga gatccttatc gatgcgatga aagtggtcgg cgaacttttc      2040
     ggatcgggga aaatgcagct tccgttcgta ttgcaaagtg ccgagacgat gaaaacgacg      2100
     gtcgattatc tcaacccgta tctctccaaa caggaaaaag ataccgatac taccctcgtt      2160
     atcggaaccg tcaaagggga cgtccatgac gtcggcaaaa atctcgtcga tattatcctc      2220
     tccaataacg ggttcaaagt gatcaatatc gggatcaaaa cggagcttga agagtacctc      2280
     gaggttatga agtctaaaga tatccacgct atcgggatgt cgggattgct ggtcaaatcg      2340
     acccaagtaa tgaaagacaa tctggagaca atggcgggca tggggatcac cactccggta      2400
     ctcttgggag gagcggcact tacccgtagc ttcgtggacg atttttgccg accgatttat      2460
     caaggtccta tcttttattg ccgcgatgcg tttgacgggg ttatcgcgat gagccgcatc      2520
     gaaaaataca atgccgatcc gagcataggg cttgatacac gtttgggcgg cgatatggta      2580
     gaaaagtctg tcaaggaagt tatcgacgta gtcatccctc catttcatga gctgaaaatg      2640
     ccttctcgtg aagttaaaat ccccacccct ccgttttggg ggcgtcgcgt attgcgcaaa      2700
     gagcagctcg actttgatat ggtgtgtgaa tggatcaata aacgaagcct ctttaaactg      2760
     cactggggat acaagcgcgc cggaatgccg gtagatgaat acaaaaaact tttagaaacc      2820
     aaagtctatc cggcctatga gcggatcaaa cgtgagatag tgaagcgggg actgtttgat      2880
     ccgacgataa tctacggcta ctatcccgtt cgaagcagcg atcaggaact ccttattttt      2940
     gatgagagca gcggatggaa catcgatgaa aatgctaatc gccagcctct ggatgaagtg      3000
     atcggaaatg ccaaatatgt attcgaattt ccgcgtcagc gcaaagtacc acatcgggcg      3060
     ttaagtgatt tttttactca tacgcgtgat gacgtattgc cgctaacgtg tgtcagtgtc      3120
     ggggacaaat tcagcgagta tgaaaaagag ctctacgcag ccaatgaata tctggaatat      3180
     aatctggtac acggatttgg ggtagagctg gccgaagcgc tggccgaagt ggcgcataaa      3240
     caaatacggc tcgatctgaa tatcgcgagt gatgacgaag ggttcagcct gcgtgatgtc      3300
     cgcatgaatc gctatgcggg tgcacgatac agtttcggat atcctgcatg tcctgatttg      3360
     gagccgagcc gtattatctt tgatctgttg cgtcctgaag agttcgggat tactctcagt      3420
     gaaacgttcc aaattcaccc tgagcagagt acgacggcgc tcgttgtcca tcacaaagaa      3480
     gcgacgtatt acaatattta a                                                3501
//

If you have problems or comments...

PBIL Back to PBIL home page