(data stored in ACNUC7421 zone)

EMBL: CP002355.PE142

CP002355.PE142       Location/Qualifiers
FT   CDS_pept        145987..148578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0143"
FT                   /product="histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR022272: IPR004358: IPR005467: IPR001638: IPR
FT                   003594; KEGG: abu:Abu_1637 two-component sensor histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   extracellular solute-binding protein family 3; SMART:
FT                   ATP-binding region ATPase domain protein; extracellular
FT                   solute-binding protein family 3; SPTR: Histidine kinase;
FT                   PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; Bacterial extracellular solute-binding proteins,
FT                   family 3; NMT1/THI5 like"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32810"
FT                   /db_xref="GOA:E4TXB3"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB3"
FT                   /protein_id="ADR32810.1"
FT                   /translation="MKKLFLFLLIFTVSLWGVEKVTLQLPWLHQFQFAGYYVAKEKGYF
FT                   SDEGLDVTILDANKKEASLKSVLDGRAQYGVGHSSLIVNYINGAPIVLMAAAYQSSPMI
FT                   LLTRKDANITGPKDLKNKRVMLTDDMVQWAEIQAMLRSIGMSTKDLIVQPHSYDSMSLS
FT                   RRETDAMVAYVSNEPFILKQAGLETYAIDPKNYGFNYYSDILFTSKEETVRHPERVEAF
FT                   YNASIQGWLWAFDHIEETAALIYRKYNPQHKSLEALIYEGKVLKELAFRPNTPFGTIDQ
FT                   SRLELIAQGYRLMGAVKAIPPFEPLLYKHDKLHLSDQEKEWLKMHPVIRVGVDHNWPPI
FT                   ESVDEKGRYTGISASYLHFLEKRLGVRFDVDYSRPLWSDSIRAVNNKELDMLSCAAIAD
FT                   NRNDKLRFSRPYLKQTVVIVTNSNVGYVNDLNDLNGKKVAVVRSYASEEYLRTYYPKII
FT                   PVLADSSLEALKKVASGEAYACIEGLSVVSYLIERHNLKNIKVVGETPFRYELAFAFRK
FT                   DWGIMASISDKVLASVTPAEYEEIHGHWLEMKHDEPVNYRLVWGIAGFMALLFFLVAYK
FT                   NHRLDVLVRQRTGELETFNQRLQDEVDKAVEKNRKQEKLLMQQAKMAEIGSMLESIAHQ
FT                   WRQPLNILGLSMTRLNLSCALSGKSESAKVIEIAEAQIEYMSQTIDDFRNFFKQDRSQI
FT                   PVNIAAMVNDVEALLGPLLVRKKITVKHEIDPLIEVLVYPNELKQVIINLVNNAREAIE
FT                   QRRGNERIIYIRCENDKRYCTISIEDTGGGIDASIIDKIFDPYFTTKFESQGTGIGLYM
FT                   AKMIIEKHFLGKLSVYNTSKGACFEIRLNREQKKDTEENKVLKRESTDGSL"
     atgaaaaaac tttttttatt tttactcatt tttacagttt cgctctgggg tgtagaaaag        60
     gtgactctac agttgccatg gctccatcag ttccagtttg ccggatatta tgttgccaaa       120
     gaaaaagggt atttctcgga tgagggttta gatgttacca tcttggacgc caataagaaa       180
     gaggcatcat taaaaagtgt tttggacggt agggcgcaat acggagtggg acactcttcg       240
     ttgatcgtta attatattaa cggtgcaccg atcgtcctga tggcagccgc gtatcaatct       300
     tcccccatga ttttgttgac acgcaaagat gcgaatatta ccggtcctaa agatttaaag       360
     aacaaacggg tcatgttaac cgatgatatg gttcaatggg ctgaaattca ggcaatgctt       420
     cgaagcatcg gtatgagcac aaaagatttg atagtgcagc ctcattcgta tgattctatg       480
     tcgttatccc gtcgtgaaac cgatgcgatg gtcgcttatg tttcaaacga accgtttatt       540
     ttaaaacaag cagggttaga aacctatgca atagatccga aaaactacgg atttaattat       600
     tacagcgata ttctatttac aagtaaagag gagactgtcc gccatcctga acgggtagag       660
     gctttttaca atgcgtcaat acaaggatgg ctctgggcgt ttgaccatat cgaagagaca       720
     gccgcactga tttatcgaaa gtataatcct cagcataaat ctctggaagc cttgatttat       780
     gaggggaaag tcctcaaaga acttgcattt cgccccaata ccccttttgg aacgattgat       840
     cagagccggc tggagcttat tgcacagggc tatcggctta tgggggcggt gaaagcgatt       900
     cctccgtttg aacctttgct gtataagcat gataaactgc atttgagcga tcaagaaaaa       960
     gagtggttaa aaatgcatcc ggtcattcgt gtcggggtag atcataattg gccccctatt      1020
     gaatcggttg acgaaaaagg gagatatacg ggaatcagtg cgtcgtatct gcattttctc      1080
     gaaaagcggc tgggggtccg ttttgacgtt gattacagtc ggccgctttg gagcgattcg      1140
     atccgggcag tcaataacaa agaacttgat atgctctcgt gtgccgcaat tgccgataat      1200
     agaaatgata aactgagatt cagccgtccg tatttgaaac aaacggtggt catcgtaacc      1260
     aattcaaatg tcggatacgt taacgattta aatgatttga acgggaaaaa agttgctgtc      1320
     gtccgttcct acgcaagtga agagtattta cgaacctatt atccaaagat cattccggtt      1380
     ttagccgaca gttccctgga agcactcaaa aaagtcgctt caggggaagc gtatgcctgc      1440
     atcgaagggt taagtgtcgt gagttatttg atagaacggc acaatctcaa aaatattaaa      1500
     gtggtgggag agacgccgtt tcgatacgaa ctcgcttttg cctttcgcaa ggattggggg      1560
     atcatggcct caatatccga caaagtactg gcttctgtta cccctgcgga atatgaagag      1620
     atacacgggc actggcttga gatgaaacac gatgagcctg tcaattatcg tctagtatgg      1680
     ggaatcgcag ggtttatggc tttattgttt tttctggtgg cttataaaaa tcaccgattg      1740
     gatgtactgg tacgccagcg tacgggtgag ctggagacgt ttaatcaacg gcttcaggat      1800
     gaagttgaca aagcggttga aaaaaatcgg aagcaggaaa aactgctgat gcagcaggcc      1860
     aaaatggcgg aaatcggttc aatgcttgaa tcgattgccc atcagtggcg ccagccgtta      1920
     aatattctgg gactttccat gacacggttg aatctgagtt gtgctttgag tgggaaaagc      1980
     gaatcggcga aagtgattga aatcgctgaa gcacaaattg aatatatgtc tcagaccatt      2040
     gacgattttc gcaatttttt caaacaggac cgaagccaaa tacctgtgaa tatcgccgca      2100
     atggttaatg atgtcgaagc gttattagga cctttgcttg ttcgtaaaaa aataaccgtt      2160
     aagcatgaaa tcgatccttt gattgaagta ctggtttacc cgaatgaact caagcaggtg      2220
     atcatcaatc tggtcaataa cgcccgtgaa gcgattgaac agcgccgcgg taatgaacgg      2280
     attatttata ttcgctgcga gaacgataag cgctattgta cgatcagtat cgaagatacg      2340
     gggggcggga ttgatgcgtc gataatcgac aagattttcg atccttattt tacgacaaaa      2400
     tttgaatccc aagggacggg aatcgggctc tatatggcca aaatgattat tgagaaacat      2460
     tttttaggga aactgagtgt ttataacacg agtaaagggg catgttttga gattcggctt      2520
     aatcgtgagc aaaaaaagga tacggaagag aataaagtgt tgaagagaga aagtacagac      2580
     ggctcactgt ga                                                          2592
//

If you have problems or comments...

PBIL Back to PBIL home page