(data stored in ACNUC7421 zone)

EMBL: CP002355.PE144

CP002355.PE144       Location/Qualifiers
FT   CDS_pept        149519..150304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tmt:Tmath_2211 hypothetical protein; SPTR:
FT                   Spore photoproduct lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32812"
FT                   /db_xref="GOA:E4TXB5"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB5"
FT                   /protein_id="ADR32812.1"
FT                   /translation="MIYLITALDAEAKPLWDHYRLKRDSSLPYTLYRNDEMTLLVGGIG
FT                   KANTMMALSALLGWRIPETGDILINIGICGAPSEYTIGEALLIHQIFEGERRYYPDILY
FT                   PHTLRESSLVCINSPQSIVRDYPVDMESSALFQAASRFFKLHQMAFIKIVSDHFTPESV
FT                   TKEGAMDLVRSHVKTLDELIRNLQSVQVDSLLFTSEERQKIDALKGHFTKSQGDALEDA
FT                   LNYFRLKNPEQSLKIDHDIPHSKRERSQLLETLIIALTA"
     atgatttatc taattaccgc actcgatgcc gaagccaaac ctttatggga tcattaccgt        60
     ctcaaacgcg attcgtcgct cccttatacc ctttatcgaa atgatgagat gacgcttttg       120
     gtgggcggga tcggtaaagc caatacgatg atggcgctca gtgctctgct gggatggcgg       180
     attcctgaaa cgggagatat tttgattaat atcggaatct gcggtgcacc ctcagagtat       240
     acgatcggcg aagccctttt gatccaccaa atctttgagg gggaacggcg ctattatccc       300
     gatatccttt accctcatac tcttcgggaa tcatcgctcg tgtgtataaa ttctccccag       360
     tcaatagtcc gcgattatcc tgtcgatatg gagagcagcg ccctctttca ggccgcatcc       420
     cgttttttca agcttcatca aatggcattt attaaaatag tatcggacca ttttacaccc       480
     gaaagcgtga cgaaagaggg ggctatggat cttgtgcgct ctcatgtgaa gaccttggac       540
     gaactcatac gcaatctcca atcggttcaa gtcgattctt tgctgtttac atctgaagag       600
     aggcaaaaaa ttgatgcctt aaaagggcac tttaccaaaa gtcaggggga tgctctggaa       660
     gatgcgttga actattttcg gctaaaaaat ccggaacaat ccctcaaaat cgatcatgac       720
     attccccatt ccaaacgcga aaggagccaa ttgcttgaaa cactcatcat tgccctcaca       780
     gcctaa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page