(data stored in ACNUC7421 zone)

EMBL: CP002355.PE145

CP002355.PE145       Location/Qualifiers
FT   CDS_pept        150273..151292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0146"
FT                   /product="DNA repair photolyase-like protein"
FT                   /note="COGs: COG1533 DNA repair photolyase; KEGG:
FT                   csc:Csac_0382 DNA repair photolyase-like protein; SPTR: DNA
FT                   repair photolyase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32813"
FT                   /db_xref="GOA:E4TXB6"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB6"
FT                   /protein_id="ADR32813.1"
FT                   /translation="MKHSSLPSQPKLFSHLYIERGILEHPQTQMIRVKFSDSQVIVIEH
FT                   YKEVFNRSAQSFAAQSSAKKLILARKEGKFLHEGSQYSDGFGIKQFFYASSVMGCLYDC
FT                   DYCYLQGLYPSANTVLFVNLEDAFEQLTPYLGEDTLVATSYDTDTMAIESLTHQTKSWL
FT                   DFAAQNEKLHLEIRTKSANIKALKNNIPNDRVTLAWTLSPQEIIDRYEHATPSLQKRLS
FT                   AVREAIQLGWKVRLCIDPVIYTENFDSLYPQLIETIFATIDPESIEHLTLGSFRMSQSH
FT                   LRSLKKLRRSDVAFFPYTVKDEMATYPETVESYILETLLAKATQYLPQERIRTWQRQS"
     ttgaaacact catcattgcc ctcacagcct aaactctttt cgcatcttta tatcgaaaga        60
     gggatattgg agcatccgca gacccaaatg atccgtgtca aattttccga ttcgcaggtc       120
     atcgtaattg agcactacaa agaggttttt aaccgctccg cacagagttt tgccgcccaa       180
     agcagcgcta aaaaactgat tttagcccgt aaagagggaa aattcctgca tgaggggagc       240
     caatacagcg acggattcgg aataaagcag tttttttacg cttccagcgt tatggggtgc       300
     ttatacgact gcgactactg ctatcttcag ggactgtacc catcggctaa cacggtgtta       360
     ttcgtcaatc tcgaggacgc gtttgaacaa ttgacccctt atttagggga ggataccctt       420
     gttgcgacct cgtatgatac cgatacgatg gccatcgaat cgctaacaca ccaaacaaaa       480
     agttggttgg attttgcggc acagaatgaa aagcttcatc ttgaaatccg taccaaaagt       540
     gccaatatca aagcactcaa aaataatata cccaatgatc gggtgacatt ggcgtggacc       600
     ctctcgccgc aggagataat cgatcgatac gaacacgcta ccccatcgct tcaaaagcgg       660
     ttgtctgcag tacgcgaagc gatccaatta ggatggaaag tacgtctatg tatcgatccg       720
     gttatctata cggaaaactt cgatagcctt tatccacaac tgattgagac aattttcgct       780
     acaattgatc ctgaatcaat cgagcacctt acattgggga gttttcgaat gagccaaagc       840
     catcttcgtt ccctcaaaaa actccgccgc agcgatgtgg catttttccc ctacacggta       900
     aaagatgaga tggcaactta tcccgaaaca gttgaatcgt atattttaga gactttgctg       960
     gcaaaagcaa cacagtatct accgcaagag aggattagaa catggcaacg gcaatcgtaa      1020
//

If you have problems or comments...

PBIL Back to PBIL home page