(data stored in ACNUC7421 zone)

EMBL: CP002355.PE147

CP002355.PE147       Location/Qualifiers
FT   CDS_pept        152062..153774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0148"
FT                   /product="flagellar hook-associated 2 domain-containing
FT                   protein"
FT                   /note="COGs: COG1345 Flagellar capping protein; InterPro
FT                   IPR003481: IPR010810: IPR010809; KEGG: wsu:WS0150 flagellar
FT                   capping protein; PFAM: flagellar hook-associated 2
FT                   domain-containing protein; flagellar hook-associated
FT                   protein 2 domain-containing protein; flagellin hook IN
FT                   repeat protein; SPTR: FLAGELLAR HOOK-ASSOCIATED PROTEIN 2;
FT                   PFAM: Flagellar hook-associated protein 2 C-terminus;
FT                   Flagellin hook IN motif"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32815"
FT                   /db_xref="GOA:E4TXB8"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB8"
FT                   /protein_id="ADR32815.1"
FT                   /translation="MSGTINSLGLGSGVLTADLIDKLKASDEAVSVTPFDSKISLNKQK
FT                   SQALDLLNSLLTTFKSSVNALDNDSLYQKRSVSGTNDGVSVSASAGSQIRDFSIGITNI
FT                   AKKNVVQSASFSSNTDKIANTDGKLNLNISGKNYTIDYTATTTLDDIKQSINDAAGSDV
FT                   SASVLQTGTSAYSLVVTSKVTGKEQTISLTDISGNLKNNNLVSEGVASGSFIAADDFIA
FT                   NTGAAGTMSVNVGGVGYNFAYDDTTTLEQMVDNINNDSTLSGKISASIVQYGANDYRMV
FT                   LTPKDGTEGSAITITDTPSSGTGLVGVMTGTTDKGGLVNTVQNGQDASFTFDGIAMTRS
FT                   TNTITDIATGLTINLLQDGGSSNISISQDRDQIATELEGLVSSYNTLQQQLDSMLSSDS
FT                   EAGTVGIFNGDNTIRNIGREITKMINSVDSKGSSLANYGIDLTRDGTMTFDKSVFTEKM
FT                   DADPEGTEAFFSGKTTVNSVGSETYTKGVFTTLSDLMTSYVGSSGTVTNLVTDTKSATT
FT                   SLNEERAKAVKLLEARYATLTAKFAAYDSMISKLNSQFSALQQQIDAAANANN"
     atgtcaggaa caataaattc actcggattg ggatcgggcg ttttaacagc ggatcttatt        60
     gataaattaa aagcaagtga tgaagccgta agtgttacgc cgttcgatag caaaatatct       120
     ctcaataagc aaaaatctca ggctttagat cttttaaaca gtttattgac aacctttaaa       180
     agcagtgtca atgcccttga taatgacagt ttgtaccaaa aaagatcggt aagcggcacg       240
     aatgacggtg tgagcgtgag tgcgagtgca ggtagccaga tacgtgattt ttcaatcgga       300
     attaccaata tcgcgaaaaa aaatgtagtg caatcggctt ctttttcctc taacaccgat       360
     aaaatcgcca atacggacgg aaagctgaat cttaatatca gcggtaaaaa ttacacgatc       420
     gactacacgg cgacaacgac gttggatgac atcaagcagt ctatcaatga tgccgccgga       480
     tcagacgtga gcgcaagcgt tcttcagacc gggacatcgg cttacagttt ggtggtaacc       540
     tcgaaggtaa cgggaaaaga gcagaccatc tctttaacgg atatatccgg taatttaaaa       600
     aataacaatt tagtgagcga aggggttgct tcaggctcct ttattgccgc cgatgatttt       660
     atagccaata ccggagcagc gggtacgatg agtgttaatg tcggaggggt cggatacaat       720
     tttgcgtacg atgatacgac aaccctagag caaatggtcg ataacattaa caatgactcc       780
     actcttagcg gcaaaatatc ggcaagcatc gtacaatacg gagcgaatga ttatcgtatg       840
     gtattaacgc ctaaagacgg aacggaaggg agtgcaataa ccattacgga tacaccgtcc       900
     agcggaacag gattggtggg cgttatgacg gggacgaccg ataagggcgg tttggtcaat       960
     acggtacaaa acgggcaaga cgcgtcattt acctttgacg ggatcgccat gactagatcc      1020
     accaatacga taaccgatat tgcgacggga ttaaccatta atttgcttca agacggggga      1080
     agttcgaata tttcgatttc tcaggatcga gatcagattg caacggagct tgaaggactt      1140
     gtcagcagtt ataacacatt gcagcaacaa cttgacagta tgctctcttc cgatagcgaa      1200
     gcagggacag tcggtatttt taacggtgac aatacgatcc gcaatatcgg tcgagaaatt      1260
     accaaaatga tcaattcggt cgattcaaaa gggtcttcgt tagcgaatta cggtatcgat      1320
     ttgacccgtg acgggacaat gacgtttgat aaaagtgttt ttactgaaaa aatggatgct      1380
     gatccggaag ggacagaagc cttttttagc ggaaaaacta cggtaaattc cgtaggaagt      1440
     gaaacctata caaaaggtgt atttacgaca ctttctgatc tgatgacaag ctatgtcggt      1500
     tcttccggta ccgttaccaa cttggtaacc gatacaaaaa gcgcaacaac gtctttaaat      1560
     gaagaacggg caaaagcggt taaattgcta gaagcacgat acgcgacatt aacggcaaaa      1620
     tttgcggcct atgattctat gatcagcaaa ttaaactccc agttttcagc tctccagcaa      1680
     caaattgatg cggctgcaaa tgccaataat taa                                   1713
//

If you have problems or comments...

PBIL Back to PBIL home page