(data stored in ACNUC7421 zone)

EMBL: CP002355.PE148

CP002355.PE148       Location/Qualifiers
FT   CDS_pept        153761..154003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0149"
FT                   /product="co-chaperone HscB"
FT                   /note="KEGG: reh:H16_A1162 co-chaperone HscB; SPTR:
FT                   Chaperone protein (HscB)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32816"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXB9"
FT                   /protein_id="ADR32816.1"
FT                   /translation="MPIIKINVEEWSEAFQKAINSKNMGQIQALIRSLPVFEREEEIRD
FT                   VLLQTMDAEATVLEIRERLVEERKRHSHFYKNNVV"
     atgccaataa ttaagataaa tgtagaagag tggtctgaag cttttcaaaa agcgattaat        60
     tcaaagaata tggggcagat ccaagcattg atccgatcgc ttcccgtctt tgaaagggag       120
     gaagagataa gagatgtact tttgcaaaca atggatgccg aagcgaccgt attggaaata       180
     agggaacgtt tggttgagga gagaaagcgg catagtcact tctataaaaa taatgtagtt       240
     taa                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page