(data stored in ACNUC7421 zone)

EMBL: CP002355.PE149

CP002355.PE149       Location/Qualifiers
FT   CDS_pept        154053..155060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0150"
FT                   /product="UDP-N-acetylglucosamine 4,6-dehydratase"
FT                   /note="COGs: COG1086 nucleoside-diphosphate sugar
FT                   epimerase; InterPro IPR020025: IPR003869; KEGG:
FT                   sdl:Sdel_2208 UDP-N-acetylglucosamine 4,6-dehydratase;
FT                   PFAM: polysaccharide biosynthesis protein CapD; SPTR:
FT                   UDP-N-acetylglucosamine 4,6-dehydratase; TIGRFAM:
FT                   UDP-N-acetylglucosamine 4,6-dehydratase; PFAM:
FT                   Polysaccharide biosynthesis protein; TIGRFAM:
FT                   UDP-N-acetylglucosamine 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32817"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR020025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC0"
FT                   /protein_id="ADR32817.1"
FT                   /translation="MLNGKNILITGGTGSFGKQFVKTILKRYKPNKIIIYSRDELKQYE
FT                   MAQRFNDPCMRYFIGDVRDLSRLESAMSGVDYVVHAAALKHVPIAEYNPMECIKTNING
FT                   AQNVIDAALHCGVSRVIALSTDKAASPINLYGATKLASDKLFVAANNIRGGKDIRFAVV
FT                   RYGNVLGSRGSVVPFFQKLIAEGAKELPITDERMTRFWITLQEGVDFVLKNFQRMHGGE
FT                   TFIPKIPSMKVVDVATAIAPHLPHKNVGIRPGEKMHEVMCPRDDSHLTLEFHDHYVIKP
FT                   TIQFTEAADFAKNNCGEIGTPVEYGFKYSSETNTDWLTPEALLEKIALTENEEK"
     atgctcaacg gaaaaaatat tcttatcacc ggtggaactg gaagcttcgg aaagcaattc        60
     gtaaaaacga ttttaaaacg ctacaaaccc aataaaatca tcatctactc ccgtgacgaa       120
     ctcaaacaat acgaaatggc acagcggttt aatgacccgt gtatgcgtta ttttatcgga       180
     gatgtccgtg atctttcacg actggaaagt gctatgagcg gtgtcgatta tgtggtacat       240
     gccgcagcgc tcaaacatgt tcctatcgcc gagtacaatc cgatggagtg tatcaaaacg       300
     aatatcaacg gggcgcaaaa cgtcatcgat gccgcactcc attgcggtgt tagccgtgtg       360
     attgccctct ccaccgataa agccgccagt cctatcaacc tctacggcgc taccaaactc       420
     gcatccgata agctatttgt cgcggcaaac aatattcgcg gcgggaaaga tatacgtttt       480
     gccgttgtcc gttatgggaa tgttttgggc tctcgcggat cggttgttcc gttttttcaa       540
     aagctgatcg ctgagggggc aaaagaactt cctattaccg atgagcggat gacacgattt       600
     tggatcactc tccaagaggg ggtcgatttc gtgttgaaaa attttcagcg tatgcacgga       660
     ggagagacct ttatcccgaa aattccctcg atgaaagtgg tggatgttgc taccgcgatc       720
     gctccgcatc ttcctcataa aaatgttggg attcgtccgg gtgagaaaat gcacgaagtg       780
     atgtgtccgc gtgatgattc ccatctcaca ttggaatttc acgaccatta cgtgatcaaa       840
     ccgacgatcc aatttaccga agcggccgat tttgcgaaaa acaattgcgg ggagatcgga       900
     acaccggtcg aatacgggtt taagtacagt tctgaaacga ataccgactg gctcacacct       960
     gaagcactgt tagagaaaat cgcattgacg gaaaatgagg aaaaatga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page