(data stored in ACNUC7421 zone)

EMBL: CP002355.PE15

CP002355.PE15        Location/Qualifiers
FT   CDS_pept        complement(16875..18140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_2284 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32683"
FT                   /db_xref="GOA:E4TW67"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW67"
FT                   /protein_id="ADR32683.1"
FT                   /translation="MYNGLSLDQAPPISAVMRFFLTVPLFGILLSLSIFFHPEAVLTPA
FT                   HPISLAVIHMMFLGVITMAMIGALFQMQSVLGGRPIPAASGNALIIHVFLTVGILSLSG
FT                   AFAFNASVMFIVAAVFLASSILYTANLILPLLFGGVTHDTLRGMRLALISLSLTALFGI
FT                   VMASSYANSSFSTMHDAIRTSHYSLGLIGWIGTLIVAVAFQVIEMFYVTIPYNGWCKRN
FT                   AFRIIAASLFLKVVWLFFAFPYVWIFDLTLGALFTGFIITTLKRLQLRKRRVSDVSILF
FT                   WTTGIALLYIAIMAYGVYEWGNYKPLLSISLIAFILFSLSIILGMMGKIVPFLVWFHLS
FT                   SNGIMDAPIMSNIIPQSRAKTLFSLFLLTTFSLLGGIFVLELFVVGAIAASAMFALLLF
FT                   NLINALRVYRFSMIHGLRFEQI"
     atgtataacg gactctccct cgaccaggct ccccctattt cagcggtgat gcgctttttt        60
     ctcaccgttc cgttattcgg aattctcctg tccctgagca ttttctttca tcctgaagct       120
     gttttaactc ccgcccatcc aatctctctt gcagtgattc atatgatgtt tttgggggtt       180
     ataaccatgg cgatgatcgg agcgctgttt cagatgcaga gtgttttggg tgggcgtcct       240
     atccccgctg caagcggaaa tgctttaatc attcatgttt ttttaacggt aggcatactc       300
     tctttatccg gggcttttgc ctttaatgcc tctgttatgt ttatcgtcgc cgccgtgttt       360
     ttagcctcat ctatcctcta caccgccaat ctcatcctcc cgctcctttt cggaggagta       420
     acccatgata cgcttcgagg gatgcggctc gcccttatct ccctttcgct aacagccctt       480
     ttcggtattg ttatggcatc atcgtatgcc aatagctctt ttagcaccat gcatgatgct       540
     attcgcacat cccactattc tctgggactc atcggatgga tcggcaccct tatcgttgcg       600
     gtagcttttc aggttatcga aatgttttac gtcacgatac cttacaacgg ctggtgcaag       660
     cgtaacgcat tcagaattat tgccgcttcg ctgtttctga aagtcgtctg gctctttttt       720
     gcatttccgt atgtctggat atttgatctg acgctcgggg cattatttac tggatttatt       780
     atcaccacgc taaagaggct tcagctgcgc aaacgccgtg ttagtgacgt gagtattttg       840
     ttttggacta cggggattgc tttgctgtac attgctatta tggcatacgg tgtctatgaa       900
     tgggggaatt ataagcccct gcttagcatc tcccttatcg cattcattct tttttcactc       960
     tcgatcattt tagggatgat ggggaaaatc gtcccgtttc tggtgtggtt tcatctgagt      1020
     tcaaacggga ttatggatgc ccctattatg tcgaatatta ttccgcaatc acgtgccaaa      1080
     actctttttt cccttttcct gctcacaact ttttcgcttc ttggcggaat ctttgtattg      1140
     gaactgtttg tcgtcggcgc cattgcggct tcggcaatgt tcgctctttt attgtttaat      1200
     ctcatcaatg cccttagagt gtatcgattc agtatgatac acggccttcg ttttgagcag      1260
     atataa                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page