(data stored in ACNUC7421 zone)

EMBL: CP002355.PE150

CP002355.PE150       Location/Qualifiers
FT   CDS_pept        155057..156184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0151"
FT                   /product="UDP-4-keto-6-deoxy-N-acetylglucosamine
FT                   4-aminotransferase"
FT                   /note="COGs: COG0399 pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis;
FT                   InterPro IPR000653: IPR020026; KEGG: sdl:Sdel_2209
FT                   UDP-4-keto-6-deoxy-N-acetylglucosamine4-aminotra nsferase;
FT                   PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   SPTR:UDP-4-keto-6-deoxy-N-acetylglucosamine4-aminot
FT                   ransferase; TIGRFAM: UDP-4-keto-6-deoxy-N-acetylglucosamine
FT                   4-aminotransferase; PFAM: DegT/DnrJ/EryC1/StrS
FT                   aminotransferase family; TIGRFAM:
FT                   UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32818"
FT                   /db_xref="GOA:E4TXC1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020026"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC1"
FT                   /protein_id="ADR32818.1"
FT                   /translation="MIPYSTQFIEEDDIAAVVDVLKSSHLTQGAKVEEFEAAIAEYVGA
FT                   RFCVAFNSATSALLGAYAVAEIGENDEIITTPISFVATSNMAIALGAKPVFCDVKTDGN
FT                   IDESLIESLITPRTRALVPVDFAGKPVAIEAIKAIAKKHNLLVIEDSSHALGSGIGTQR
FT                   IGSFADMTIFSFHAIKPITTGEGGAVVTNDEAFAQKLKLFRSHGIIKKQLWNSDMVSLG
FT                   HNFRLTEFAAALGLSQLHKLDRFLATRNEIARYYDERFAGHKLFATIAIDADEQSARHL
FT                   YPLLLSPALHCSKEDVFTELQTRGLGVQVHYKPIYQNSFYKERFGEQRLANTEHFYKSS
FT                   LSIPCHQKMSMEDARIVADTVLEVMEHYSHRECSF"
     atgatcccgt attccacaca gtttatcgaa gaggatgata ttgccgccgt tgtcgatgtg        60
     ctcaaaagct cgcatctaac ccaaggagcg aaagttgagg agtttgaagc tgcgattgcc       120
     gagtatgtcg gagcgcgttt ttgtgtcgcg tttaactccg ccacctccgc gttgttgggt       180
     gcctatgccg ttgccgagat cggtgaaaat gatgagatta tcacaactcc gatcagtttt       240
     gtcgcaacgt cgaacatggc gattgcattg ggagcaaaac ccgttttctg cgatgttaaa       300
     acggacggaa acatcgacga atcgttgatc gaatcgctca tcactccacg aacccgcgca       360
     ctcgtccccg tcgatttcgc cggcaagccg gttgcgatag aggcgatcaa agcgatagcc       420
     aaaaagcaca atctcctcgt cattgaagat tcttcccatg ctttgggaag cggtatcggc       480
     actcaaagaa tcggttcttt tgccgacatg acgattttta gtttccatgc gatcaaaccg       540
     attaccacgg gagagggggg tgcggttgtc accaatgacg aagcgttcgc ccaaaaactc       600
     aaactcttcc gctcacacgg catcatcaaa aaacagcttt ggaactccga tatggtgagt       660
     ttggggcata atttccgcct caccgaattt gccgctgcgt tgggactttc acagctccac       720
     aaactggatc gttttttggc aacacgcaat gaaatcgccc gttattacga tgagcgtttt       780
     gcagggcata aactattcgc gacgattgcg attgatgcgg atgagcagag tgcgcggcat       840
     ctttatccgt tactcttatc ccctgcactg cactgttcga aagaggatgt ttttaccgaa       900
     ttgcaaacac gcggattagg ggttcaagtt cactacaaac cgatctacca aaacagtttt       960
     tacaaagagc gtttcggcga acagcgattg gcgaatacgg agcactttta caaaagctcc      1020
     ctttccattc cgtgtcatca gaagatgagc atggaggatg cacggatcgt cgccgatacg      1080
     gttcttgaag tgatggaaca ctattcccat agagagtgca gtttttaa                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page