(data stored in ACNUC7421 zone)

EMBL: CP002355.PE152

CP002355.PE152       Location/Qualifiers
FT   CDS_pept        156878..157741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0153"
FT                   /product="pseudaminic acid biosynthesis-associated protein
FT                   PseG"
FT                   /note="COGs: COG3980 Spore coat polysaccharide biosynthesis
FT                   protein predicted glycosyltransferase; InterPro IPR020023;
FT                   KEGG: sdl:Sdel_2211 pseudaminic acid
FT                   biosynthesis-associated protein PseG; SPTR: Pseudaminic
FT                   acid biosynthesis-associated protein PseG; TIGRFAM:
FT                   pseudaminic acid biosynthesis-associated protein PseG;
FT                   TIGRFAM: pseudaminic acid biosynthesis-associated protein
FT                   PseG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32820"
FT                   /db_xref="InterPro:IPR020023"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC3"
FT                   /protein_id="ADR32820.1"
FT                   /translation="MNLLIRADSSSSIGLGHIMRDVVFAAQYSQDSVRFACQNLSGNII
FT                   DHIPYPVHILDSNDPEELIALIREQRIDRVVFDHYGIDEIFEKKIKEACGVSILSFDDT
FT                   YEKHYCDILLNHNISADKNRYVGLVPPHCELRCGGEYTLIRDEFKTEKQVKREKLYDVF
FT                   IAMGGTDPTNATMNILSTLSDEMRVCIVTTSGNPHVSELETCVQERKNITLEIDSARIA
FT                   QLLHQSRLAIITPSVMVHEVLFMEVPFIAVQTAANQEDMVVYLQQEGYIVLKEWDAGAI
FT                   ARFYNA"
     atgaacctcc ttatccgtgc cgactcttcg agtagtatcg ggttaggaca cattatgcgc        60
     gatgtggtgt ttgccgcgca atattcgcag gattcggtac ggttcgcctg tcaaaatttg       120
     agcggtaata tcatcgatca catcccttat cccgtccata tattagattc caatgatcct       180
     gaagaactga tcgcgcttat tcgagagcag cgtatcgata gggtggtgtt cgatcactac       240
     ggtatcgatg agatattcga gaaaaaaatc aaagaagcgt gcggtgttag tattctctct       300
     tttgatgaca cgtacgaaaa acactattgt gatatcctcc tcaaccacaa catctcagcg       360
     gataaaaacc gatatgtcgg gttggttccg ccacattgtg aactccgatg cggtggggaa       420
     tatacgctga tacgcgatga gtttaaaacc gaaaagcagg tcaagcggga aaaactctac       480
     gatgttttta ttgctatggg gggaaccgat ccgaccaatg cgacgatgaa tattctctca       540
     accctaagcg atgagatgcg tgtctgtatc gtaacgacat cgggtaaccc gcatgtgagc       600
     gaattggaaa cctgtgtgca ggagagaaaa aatatcacct tggagatcga ttcagcacgg       660
     atcgcgcaat tgctccatca aagccgcttg gcgattatca cccccagtgt aatggtgcat       720
     gaggtgctgt ttatggaggt tccgtttata gccgtacaaa ctgcggctaa tcaagaggat       780
     atggttgtat atttgcagca agaggggtat atcgtgttaa aggagtggga tgcaggtgcg       840
     attgctcgat tttacaacgc ttga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page