(data stored in ACNUC7421 zone)

EMBL: CP002355.PE154

CP002355.PE154       Location/Qualifiers
FT   CDS_pept        158171..159205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0155"
FT                   /product="N-acetylneuraminate synthase"
FT                   /EC_number="2.5.1.56"
FT                   /note="COGs: COG2089 Sialic acid synthase; InterPro
FT                   IPR020030: IPR006190: IPR013132: IPR013974; KEGG:
FT                   tmt:Tmath_0718 pseudaminic acid synthase; PFAM:
FT                   N-acetylneuraminic acid synthase domain; SAF domain
FT                   protein; PRIAM: N-acetylneuraminate synthase; SPTR:
FT                   Pseudaminic acid synthase; TIGRFAM: pseudaminic acid
FT                   synthase; PFAM: SAF domain; NeuB family; TIGRFAM:
FT                   pseudaminic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32822"
FT                   /db_xref="GOA:E4TXC5"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020030"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC5"
FT                   /protein_id="ADR32822.1"
FT                   /translation="MNIAHHNTDEKVFIIAELSANHNGSLDTALRTITAMKDAGADAVK
FT                   LQTYTPDTITLDCDSEMFTISQGTLWDKRKFHDLYAEAMTPWEWHPILFDHAKSLGMAA
FT                   FSSPFDVSAVDFLESLDVPAYKIASFEITDIPLIEYTAAKGKPIIISTGIATLSDIEEA
FT                   LDACRRVGNEQIMLLKCTSAYPAALEEMNLLTIADMKIRFGVNVGLSDHTMSLAAPIAA
FT                   VALGARVIEKHFILDRGMGGADSAFSLEPHEFKMMVDAVRDTEKLLGKVTYELSPKSLK
FT                   SREFSRSLFIAEDVKEGEVISDKNVRSVRPGFGLAPKHLKEILGKTFKAGAIKGTPLSW
FT                   DHIG"
     atgaatattg cccaccataa cacagatgaa aaagtcttta ttattgccga actctccgcc        60
     aaccacaacg gctcgctcga tacggcactg cgtacgatca cagcgatgaa agatgcgggg       120
     gcggatgcgg tgaaactcca aacgtatacc cccgatacga tcactctcga ttgcgacagt       180
     gaaatgttca ccatttcgca gggaacgctg tgggacaaac ggaaatttca cgatctctac       240
     gcagaggcga tgaccccgtg ggaatggcat cctattcttt tcgatcatgc caaaagtttg       300
     gggatggcgg cattttcctc cccttttgat gtgagtgccg tcgattttct cgaatcgctc       360
     gatgtccccg cgtataagat cgccagtttt gagatcaccg atattccgct gatcgagtat       420
     acggctgcta agggaaaacc gatcatcatc tcgaccggaa tcgccacact cagcgatatt       480
     gaagaggcgt tggacgcctg ccgacgtgtc ggaaacgagc agattatgtt gctcaaatgt       540
     acctccgctt atcctgccgc tctggaagag atgaacctcc tcacgatagc tgatatgaaa       600
     attcgcttcg gagtgaatgt agggttgagt gaccacacga tgagtttggc tgcccctatc       660
     gctgctgtcg ctttgggggc tcgggtgatc gagaagcatt ttatccttga tcgaggtatg       720
     gggggagcgg atagcgcctt tagtctggag ccgcacgaat ttaaaatgat ggtcgatgcg       780
     gtacgcgaca ccgaaaaact gttggggaaa gtgacctacg aattaagtcc gaagagtttg       840
     aaatcgcgcg agttttcccg cagtttgttt atcgccgaag atgtcaaaga gggtgaagtg       900
     attagcgata aaaatgtccg ctccgtccgc cccggtttcg gattagcgcc caaacatctc       960
     aaagagattc tgggcaaaac gtttaaagcg ggcgctataa aaggaacccc gctttcatgg      1020
     gatcatatcg gatga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page