(data stored in ACNUC7421 zone)

EMBL: CP002355.PE155

CP002355.PE155       Location/Qualifiers
FT   CDS_pept        159202..160206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0156"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: npu:Npun_R0679 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32823"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC6"
FT                   /protein_id="ADR32823.1"
FT                   /translation="MTISVVSHDAGSSEILCALIREYFDLASWHIFALPQSPMGRLCER
FT                   YTLPFTPIGDPEQQFRAIQPDLLLFGTGWQEKIERPYVRFCKEHAIMSVAFLDHWSNYR
FT                   ERFGFPEGGWEENLGDFTAVSDQKALSLAEAFNLPNPVGFQNFYLRDTIAQARQKEPHS
FT                   NNNLLFLSEPTDAVALRTYGDKNYWGFTQYSALEEILKNFHRFECAGLTIRLHPSDNGS
FT                   GYKKILKAYPHIRVQINDAAVCELSDQLLSAKMIIGFDTMALYIAALLGRPVLSYLPSK
FT                   NREFLLPLPNDRQVRSLLKIPPKLLTASTLSSDDFGMDFALFIKTIVVKERNV"
     atgacgattt ccgtcgtatc ccatgatgcg ggaagttcgg agatactgtg cgcattgatt        60
     cgcgagtatt ttgaccttgc ctcatggcat atttttgcac tgcctcaaag tcctatggga       120
     agactgtgtg aacgatatac tctccccttc acaccaatcg gtgatcccga acaacagttt       180
     cgtgccattc agcccgatct gctgttattc ggaacgggat ggcaggagaa gattgagcgc       240
     ccctatgtcc gtttttgcaa agaacacgcc attatgagcg tcgctttttt ggatcattgg       300
     agcaactatc gtgagcggtt cggatttcct gagggcggtt gggaagagaa tctgggagat       360
     tttacggcag tttcggatca aaaagcgctc tctcttgccg aagcgttcaa tctccccaac       420
     cctgtcggat ttcaaaattt ttatctgcgg gatacgattg ctcaggctcg tcaaaaagag       480
     cctcattcca acaacaacct cctctttttg agcgagccga ccgatgcggt ggcgttgcgt       540
     acttacggag ataaaaacta ctggggattt acccaataca gtgcactaga ggagatattg       600
     aaaaattttc atcggtttga atgtgcggga cttacgattc ggcttcatcc tagtgataat       660
     ggaagcggtt ataaaaagat cctcaaagcc tatccccata tccgagttca aatcaatgat       720
     gcggcggtat gtgagctatc tgatcagctt ttgagtgcca agatgatcat tggattcgat       780
     acgatggccc tctatatcgc ggcactttta ggacgtcccg tcctctcgta tctcccctcg       840
     aaaaacagag aatttttact cccgcttccg aatgatcggc aggttcgttc tctattaaaa       900
     atcccaccta aacttctcac tgcttcgact ttgagtagtg atgatttcgg tatggatttt       960
     gctttattta taaaaactat agttgtaaaa gagcgaaatg tataa                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page