(data stored in ACNUC7421 zone)

EMBL: CP002355.PE156

CP002355.PE156       Location/Qualifiers
FT   CDS_pept        160199..161146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0157"
FT                   /product="oxidoreductase domain protein"
FT                   /note="COGs: COG0673 dehydrogenase and related protein;
FT                   InterPro IPR000683; KEGG: mag:amb3807 dehydrogenase and
FT                   related protein; PFAM: oxidoreductase domain protein; SPTR:
FT                   Predicted dehydrogenase and related protein; PFAM:
FT                   Oxidoreductase family, NAD-binding Rossmann fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32824"
FT                   /db_xref="GOA:E4TXC7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC7"
FT                   /protein_id="ADR32824.1"
FT                   /translation="MYKALIIGAGSIGGLIDSPTSKTVASHAHAYKKHPDTQLYAICEP
FT                   SELNVFAFMERWGEVHHYGSIDEISTDELYDIVSISSPTKSHFYDLITLLKRSDSSMIL
FT                   CEKPLVATQEELSSLSTLLMHSDKKILVHFVRRYNSAFINLAERIQKGEFGKSLGFQGV
FT                   CTKGLLHNGSHMIAVLSHFLGNVTSIKPFRASFCHDDLCGDFGISLERGDGAISVLSHP
FT                   PYSLFEITFWFETGVIKILDGGDKIEIYSRVPSTYEGYFSLALQESMTTNLSNYAYDSV
FT                   EFLLRKSKETCKNILSEHFHIHKMIFQTLAKVYP"
     atgtataaag cactgatcat cggcgccgga agtatcggcg gacttatcga ctctccgaca        60
     tcaaaaacgg ttgcgagtca tgcacatgct tataaaaagc atccggatac gcagctatat       120
     gcgatctgtg aaccctcaga actcaatgtt tttgccttta tggagcggtg gggagaggta       180
     caccattatg ggtcgattga tgagattagc accgatgagc tttatgatat tgtctctatc       240
     tcttcgccga caaaatccca tttttatgat ctgatcacct tgctcaaacg cagcgatagc       300
     tccatgatac tgtgtgaaaa acctcttgtt gcaacccaag aggaattatc ttccctctcc       360
     acacttctta tgcacagtga taaaaaaata ctggttcatt tcgttcgccg atacaatagt       420
     gcttttatca acctcgcgga gcggattcaa aagggagaat tcggtaaatc attaggattt       480
     caaggggttt gtaccaaagg gctactccac aacggttccc atatgatcgc cgtgttgagc       540
     cattttttag gcaatgttac ttcgataaaa ccgtttcgtg catcgttttg ccatgatgat       600
     ctgtgcggag atttcggtat atcgctcgaa cgcggtgacg gagctatttc ggttctgagt       660
     catccgccat actctttatt tgagataacc ttttggtttg aaacgggtgt gataaaaata       720
     ctcgacggag gggataaaat cgaaatctat tcgcgtgtcc catcgaccta tgagggatat       780
     ttttcccttg cattgcagga gagtatgacg acgaatctct ccaattatgc gtatgattca       840
     gtagaatttt tactccgtaa aagcaaagag acgtgcaaaa acattctgag cgagcatttc       900
     catattcaca agatgatttt tcaaacgctt gccaaggtat acccatga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page