(data stored in ACNUC7421 zone)

EMBL: CP002355.PE157

CP002355.PE157       Location/Qualifiers
FT   CDS_pept        161143..162444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0158"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="COGs: COG0399 pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis;
FT                   InterPro IPR000653; KEGG: phe:Phep_3939
FT                   DegT/DnrJ/EryC1/StrS aminotransferase; PFAM:
FT                   DegT/DnrJ/EryC1/StrS aminotransferase; PRIAM:
FT                   Glutamine--scyllo-inositol transaminase; SPTR: Aspartate
FT                   aminotransferase; PFAM: DegT/DnrJ/EryC1/StrS
FT                   aminotransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32825"
FT                   /db_xref="GOA:E4TXC8"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC8"
FT                   /protein_id="ADR32825.1"
FT                   /translation="MKKLAINGGEKLRTTPFPAYNTIGIEEEEAVLRVLRSGKLSTFLG
FT                   TWHDDFFGGPEVRALESEWAAYFGVKHAISVNSATSGLYAAIGACGISPGDEVIVSAYT
FT                   MSASATAALVYGAIPIFADIEEDFYCLDVKSIETKITPRTKAIIVVDIFGQPYDVEAIN
FT                   TLAKKYNLFVIEDTAQAPGAMLGEKYAGTLGDIGVYSLNYHKHIHSGEGGIIVTDDDVL
FT                   ADKIRLIRNHAEAVLSARGIKDKSELINMVGYNYRMTEIEASIARCQLKKLPSLLTQRL
FT                   ENTAYFNEQLAQIPCIKPTKIREGAKHAFYVHPLQFDAEVAGMHRNRFIDAVKAELPPT
FT                   LLREESVVLLSYGYVKPLYLQPLYQEKIAFGRDGYPFNLSEVTYPKGLCPITEEMHFNR
FT                   LVTHEFMRPGMGKADMDDVVQAFVKVWDNRAELV"
     atgaagaaac tcgccataaa cggcggagag aaactccgca cgacaccgtt tcccgcctat        60
     aacacgatcg gaatcgaaga agaagaggcg gttttgcgtg tcttgcgcag tggaaagctc       120
     tcgacgtttt tggggacatg gcatgatgac tttttcggcg gtccagaagt gcgtgcattg       180
     gaatcggaat gggcagcata tttcggtgtc aaacacgcga tcagcgtcaa ctccgcgaca       240
     tcggggcttt atgcagcgat cggagcgtgc ggaatcagtc cgggggatga ggtgatcgtc       300
     agcgcttata ctatgagtgc ctcggcgact gccgcattgg tgtacggtgc tatccctatc       360
     ttcgccgaca tcgaagagga tttttattgt ctcgatgtca aaagtatcga aaccaagatt       420
     acccctcgaa ccaaagcgat tattgtggtt gatattttcg gacagcctta tgatgtcgaa       480
     gcgatcaaca cattagcgaa aaaatataat ctttttgtca tcgaagatac ggcgcaagct       540
     ccgggtgcga tgctgggtga aaaatatgcg ggaacactcg gtgacatcgg ggtctattcg       600
     ctcaactacc acaaacacat ccatagcggg gaggggggaa tcatcgttac cgatgatgat       660
     gtcttagccg ataaaatccg ccttatccgc aaccatgccg aagcggttct ctctgcacgt       720
     gggatcaaag ataaatcaga actcatcaat atggtcggtt ataactaccg aatgacggag       780
     attgaagcgt ctatcgcccg ttgtcagctt aaaaaacttc cctctttgct gacgcaaaga       840
     ctcgaaaata ctgcatattt caatgaacag ttggcacaaa ttccctgcat aaagccgacc       900
     aaaatccgcg agggggcaaa acacgcgttt tacgtccatc cgttgcagtt cgatgcagag       960
     gtcgcaggaa tgcatcgcaa ccgttttatc gatgcggtca aagcggaact ccctccgaca      1020
     ttgctgcgtg aggagtcggt agtgctgctt agctacggct atgtcaaacc gctctatctt      1080
     caacctctct atcaggaaaa aatcgcattc ggacgggacg gttatccgtt taatctcagc      1140
     gaagttacct acccgaaagg gctctgtccg ataaccgaag agatgcattt taatcgcctc      1200
     gtcacccatg aatttatgcg tcctggaatg ggcaaagcgg atatggacga tgtcgtacaa      1260
     gcctttgtca aagtatggga caacagagcg gagcttgtat ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page