(data stored in ACNUC7421 zone)

EMBL: CP002355.PE158

CP002355.PE158       Location/Qualifiers
FT   CDS_pept        162441..162983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0159"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COGs: COG1670 Acetyltransferase including
FT                   N-acetylase of ribosomal protein; InterPro IPR000182; KEGG:
FT                   phe:Phep_3937 GCN5-related N-acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase; SPTR: Acetyltransferase,
FT                   gnat family; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32826"
FT                   /db_xref="GOA:E4TXC9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXC9"
FT                   /protein_id="ADR32826.1"
FT                   /translation="MKFEGERVYLRPIELSDADGAYPLWLNDPDVCRYNSHGDTLYTKE
FT                   MAQSYIKSVMDNPSTAVFAICLRENDRHVGNIALQQISLKNRNAELAILIGDPSVHGKG
FT                   IGYEAGKLLVEYAFSTLKLHRLYCGTHEANIGMQKLALKLGMSEEGRRREALWKNGVLA
FT                   DIVEYGLLNTVSEKETL"
     atgaaatttg agggggagcg tgtttatctg cgtccgattg aactgagtga tgccgatggc        60
     gcgtaccctt tatggttaaa cgatcccgac gtatgccgtt acaactcgca cggggatact       120
     ctgtatacga aagagatggc acaatcgtat ataaagagcg tgatggacaa cccaagcaca       180
     gccgtttttg cgatctgttt acgtgagaat gatcgtcatg tcggtaatat cgcattgcag       240
     caaatttcac tcaaaaatcg caatgccgaa ttggcaattt tgatcggaga tccctctgtt       300
     catggaaaag ggatcggcta tgaagcgggg aagcttttgg tggagtatgc ttttagtacg       360
     ttgaagctcc atcgtctcta ttgcggtacc catgaggcga atatcgggat gcaaaagttg       420
     gcgttgaagc tcggaatgag tgaggagggg cggcggcgcg aagccctttg gaaaaacggt       480
     gttttagccg atatagtgga atatggatta cttaacaccg tttctgaaaa ggagactcta       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page