(data stored in ACNUC7421 zone)

EMBL: CP002355.PE159

CP002355.PE159       Location/Qualifiers
FT   CDS_pept        162980..164113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0160"
FT                   /product="N-acetyl sugar amidotransferase"
FT                   /note="InterPro IPR020022; KEGG: tai:Taci_0673 LPS
FT                   biosynthesis protein; SPTR: LPS biosynthesis protein;
FT                   TIGRFAM: N-acetyl sugar amidotransferase; TIGRFAM: N-acetyl
FT                   sugar amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32827"
FT                   /db_xref="GOA:E4TXD0"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020022"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD0"
FT                   /protein_id="ADR32827.1"
FT                   /translation="MTKQMIFTDTPPDNYGEPLYKEYLQYCTRCCMPSSNEGMQFDELG
FT                   ICLACRAQEQKMRINWKKSEEVLRETLESYKERSGDNYDCIIPISGGKDSVFQLHVLKK
FT                   VYGMKPLAVTFNHNWYSEIGRYNLENALEKLEIDHIMFTPNKALVKKLFVKSFYKIGDS
FT                   CWHCHAGVGAFPLQIAVKFNIPLLIWGESVCESSGRADFRDNVQKFDRDYFTKVSAKLY
FT                   PEQMIDEEITRKDLKPFELPSFEDIERVGVVGLHLGDYLFWDDERQMEFIKKEYDWREE
FT                   HRPGHYKGFKGNECKFETLHDHMKYVKRGFGRGTDQASADVRAGLLTREEGFEIAKKYD
FT                   QQRPAYLDEFLDMANITEEEYNNVLKAMRQGKFRECR"
     atgaccaaac aaatgatctt taccgataca ccgccggata attacggcga accgttgtac        60
     aaagagtatc ttcaatactg tacccgctgc tgtatgccca gctcgaacga ggggatgcag       120
     ttcgatgaac tcggtatctg tttagcgtgt cgtgcgcaag agcaaaagat gcggataaac       180
     tggaaaaaaa gcgaagaagt ccttcgtgaa accctcgaga gttacaaaga gagatcggga       240
     gacaactatg attgtattat cccgatcagc ggaggaaaag acagcgtttt ccaactccat       300
     gtcctcaaaa aagtgtacgg gatgaaaccg cttgccgtga cctttaacca taactggtat       360
     tcggagatcg gtcgttataa tctcgaaaat gcccttgaaa aacttgaaat tgaccatatc       420
     atgttcaccc cgaataaagc attggtaaaa aaactgttcg tcaaatcgtt ttataaaatc       480
     ggagattctt gctggcattg tcacgccggt gtgggtgcat ttcccctcca aatcgccgtc       540
     aaattcaaca ttccgctcct catctgggga gaatcggtgt gtgagagcag cggtcgcgcc       600
     gattttcgcg ataacgttca aaagttcgac cgtgactatt tcaccaaagt ctctgccaaa       660
     ctctatcctg agcagatgat tgacgaagag atcacccgca aagatctcaa accgtttgaa       720
     ttgccgagtt ttgaggatat cgaacgtgtc ggtgtcgtag gattgcattt gggggattat       780
     ctcttttggg atgatgagcg tcagatggag tttatcaaaa aagagtacga ttggcgtgaa       840
     gagcatcgtc cgggacacta caaagggttc aaggggaacg agtgcaaatt tgaaaccctg       900
     cacgatcata tgaagtacgt taaacgggga ttcggtcggg gaaccgatca agcaagcgcc       960
     gatgtccgtg ccggattgct cactcgtgaa gaggggtttg aaatcgctaa aaagtacgac      1020
     caacagcgcc ccgcgtatct ggatgaattt ttggatatgg cgaacatcac cgaagaagaa      1080
     tacaacaatg tcctcaaagc gatgcgtcaa ggaaaattca gagagtgccg atga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page