(data stored in ACNUC7421 zone)

EMBL: CP002355.PE160

CP002355.PE160       Location/Qualifiers
FT   CDS_pept        164110..165459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0161"
FT                   /product="Amidase"
FT                   /note="COGs: COG0154 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase A subunit and related amidase; InterPro
FT                   IPR000120; KEGG: pub:SAR11_0263 amidase; PFAM: Amidase;
FT                   SPTR: Glutamyl-tRNA(Gln) amidotransferase subunit A
FT                   (Glu-ADTsubunit A); PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32828"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD1"
FT                   /protein_id="ADR32828.1"
FT                   /translation="MRLSDCTATELLERLKTNSTTPKEIAQSCIERIRAIDPMVNAWEY
FT                   FDEAAIEAQLAKIGTYNRDDYPLYGIPVGVKDIYNTFDMPTQMGSPLWSDFTPGNDARM
FT                   IHYLRRSGAVMLGKTVTAEFAVHYQDKTRNPHDLSRSPGTSSSGSAVAVATGMVPVALG
FT                   SQTAGSISRPASYCGIYGFKPTFGVLPRIGVLKTTDSLDTLGFFARSVSDLALMFEASR
FT                   VHGENYEFVHQYIDNYVSVPDKVYRIGIIKHPKWDLASESAKNAFEAWCARLKSPCLQV
FT                   QTVTLPQFCDTIHATHQTIYDKSLAYYFKEEYAKHTLMSPIFYDIIQDGLRITKEEYQD
FT                   ALEKQSRETREFDAWMDSYDILITLATADEAPIGLTTSDIPDANLIWTYLGLPIATLPV
FT                   LKGENHLPIGVSAVSRKYNDKLLLDFLQYLALLGILPMVSPITPNSKSKE"
     atgagattga gtgattgtac tgcgactgaa ttattagagc gtttgaaaac aaactccaca        60
     acacccaaag agatcgccca aagctgcatc gaacgtattc gtgcaattga tccaatggtc       120
     aatgcatggg agtatttcga tgaggctgcg attgaggcgc aacttgccaa aatcggaacc       180
     tataaccgag acgattatcc cctctacggc atccccgtcg gcgtcaagga catctataac       240
     acctttgata tgcccacaca gatgggctcg ccgttgtgga gcgactttac ccccggtaac       300
     gatgcacgga tgatccatta tcttcgccgc tccggtgccg tgatgctcgg aaaaacggta       360
     acggcggagt ttgccgtcca ttatcaggat aaaacccgaa acccgcatga tttgagccga       420
     tcaccgggga cgtcatcgag cggttcggcc gttgcggtgg caacggggat ggttccggtc       480
     gcactgggca gccaaacggc aggttcgatc agccgacctg cgagttattg cggtatctat       540
     ggatttaaac cgacgtttgg ggtattgccc cgtatcggtg tattgaaaac gaccgattcg       600
     ttggatacgc tcggattttt tgcacgaagt gttagtgatt tggcgttgat gtttgaagca       660
     tcccgcgtgc atggcgagaa ttacgagttt gttcatcaat acattgataa ttacgtctct       720
     gtccccgata aagtttatcg gatcggcatc atcaaacatc ctaaatggga tttagcctct       780
     gaatctgcca aaaatgcctt tgaggcatgg tgcgcgcgtc ttaaatctcc ttgtttgcag       840
     gtacagacgg ttacgcttcc ccaattttgc gatacgattc atgcgaccca tcagacaatc       900
     tacgataaat cgcttgcgta ctatttcaaa gaagaatacg caaaacacac cctgatgagt       960
     cctatctttt atgatattat ccaagatgga ttgcgtataa cgaaagagga gtaccaagat      1020
     gctttggaaa aacaatcgcg tgaaacacgc gaatttgatg catggatgga ttcgtatgac      1080
     atcctcatca cccttgctac cgctgatgaa gcaccgatcg ggttgacgac atcggacatt      1140
     cctgatgcaa atttgatctg gacttattta ggattaccga ttgcgacctt gccggtttta      1200
     aaaggagaaa atcatttgcc gataggggta agtgccgttt cacgaaaata taatgataaa      1260
     ctgttgcttg attttttaca gtatcttgcg ctcttgggca ttttgccgat ggtttcacca      1320
     atcaccccca attctaaatc gaaggaatga                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page