(data stored in ACNUC7421 zone)

EMBL: CP002355.PE161

CP002355.PE161       Location/Qualifiers
FT   CDS_pept        165466..166086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0162"
FT                   /product="pseudaminic acid biosynthesis-associated
FT                   methylase"
FT                   /note="InterPro IPR020027: IPR013217; KEGG: mhu:Mhun_3095
FT                   hypothetical protein; PFAM: Methyltransferase type 12;
FT                   SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   pseudaminic acid biosynthesis-associated methylase;
FT                   TIGRFAM: pseudaminic acid biosynthesis-associated
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32829"
FT                   /db_xref="GOA:E4TXD2"
FT                   /db_xref="InterPro:IPR020027"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD2"
FT                   /protein_id="ADR32829.1"
FT                   /translation="MSKFSTEQEKFWAGEFGDDYISRNRGENLIASNTVIFARLFQRIQ
FT                   KIESIIEFGANIGMNIHAIGNLLPKAYLSAVEINAVAVEHLKKIPDLNIYHQSILEFES
FT                   ERHYDLVFTKGVLIHIDPNELQNVYERMYKSSKRYIAMVEYHSPSPVELDYRGHKEKLF
FT                   KRDFAGELWEKYPDLTLLDYGFFYGRDPRHGQEDVNWFLFEKK"
     atgagtaaat ttagcactga gcaagaaaaa ttttgggcag gagagttcgg agatgattac        60
     atttcacgaa atcgaggaga aaacttaatc gcatccaata ccgtaatctt cgcccgactc       120
     tttcagcgta tacagaagat agagtcgatc attgagtttg gtgctaacat cggaatgaat       180
     atacatgcta ttgggaacct tcttcccaag gcatatctct cagcagtaga aatcaatgcc       240
     gttgcagttg agcacctcaa aaaaataccg gatttgaata tttatcacca atccatttta       300
     gaatttgaat ctgaacggca ctatgatctg gtttttacta aaggggtttt gattcatatt       360
     gacccaaatg aactccaaaa tgtttatgaa cgaatgtata agagcagcaa gcgatatata       420
     gcaatggttg agtatcacag tccatctccc gttgaactgg attatcgagg gcataaagaa       480
     aaattattta aacgggattt tgccggagag ttgtgggaaa aatatcctga cctcaccctt       540
     ttggattacg gattttttta cgggcgcgat cctcgacatg gacaagaaga tgtcaactgg       600
     tttttatttg aaaaaaagta a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page