(data stored in ACNUC7421 zone)

EMBL: CP002355.PE163

CP002355.PE163       Location/Qualifiers
FT   CDS_pept        complement(168199..170607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0164"
FT                   /product="flagellin domain protein"
FT                   /note="COGs: COG1344 Flagellin and related hook-associated
FT                   protein; InterPro IPR001492: IPR010810: IPR001029; KEGG:
FT                   dat:HRM2_36880 putative flagellin; PFAM: flagellin domain
FT                   protein; flagellin hook IN repeat protein; SPTR: Putative
FT                   flagellin; PFAM: Bacterial flagellin N-terminal helical
FT                   region; Flagellin hook IN motif; Bacterial flagellin
FT                   C-terminal helical region"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32831"
FT                   /db_xref="GOA:E4TXD4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD4"
FT                   /protein_id="ADR32831.1"
FT                   /translation="MGFRINTNIAAMTAHTSGVMNNRNLDESLSKLSSGLRINKAADDA
FT                   SGMVIANALRNQANSLGQAISNGNDAIGLIQTADGALNEYSKILDTIKTKAVQASSDGQ
FT                   NTSSRLAIQKDISRLMEELNTIAKTTSFNGQKLLSGSFTNKTIQMGASSNEGVNFSVAS
FT                   TEPNKIGHTSRAQLNLASEVGSVQLTMKSALTGENITMKAIDIQYNNTPENGMGALADE
FT                   INSHSGITGIRAKAVVEVTSGSAIAAGTTGSGFAINGINIGAINVKANDGDGALMAAIN
FT                   GKTTQTGVAATITDDGKITLKATDGRAIKVEGNVSDVFGGTANQLSTVGYIELVQKGAA
FT                   EFQVSGIGAGAVGGTINLSGATSMVKDSILAAGSSIAVGSTLKVGTTIGGDVNLTAATT
FT                   LVLDGTLKAGTTAAAGTTFAKGTTMGAAVNLTAAVALSADMYITAGSTLVSGTIFDAGT
FT                   LVQQDFTVNGVTYHKGDVLSSDVTLTASLTLTSDMTINVDLSGTANSSIATASTINVGS
FT                   VLGGNIVSSSTATVSEDMTLKSGSILAAASKLKAGSVLGADTVNSSAVTTYTTTDLKAG
FT                   SSLAAASTLKEGSTIGGTVINSSAITLNADMTIKAGSTLATGTVIKAGTVLMQDLTAAQ
FT                   TGASAMSAGDKVTVDITTGAAITLSADLTLLRGTGTAPTIAAGSTLMPNTENSGRVGID
FT                   AGEVTNLSSISVLNLTDAMKAIDTLDAAIGDLDTIRADLGSVQNQLTATINNISVTQVN
FT                   VKAAESQLRDVDFAAESANFSKFNILAQSGSYAMSQANAVQQNVLKLLQ"
     atgggttttc gaattaacac taacatcgca gcaatgactg cccatacaag tggggtaatg        60
     aacaatcgta atttggacga gtctctctcc aaactcagtt caggtcttcg tattaacaaa       120
     gccgcagacg atgcatcagg gatggttatt gccaatgcgc ttcgtaacca agcaaactct       180
     ctgggacaag cgatctctaa cggtaacgat gcaatcggtt tgatccaaac ggcggacggt       240
     gcactcaacg agtactcaaa aatcctcgac accattaaaa ccaaagcagt tcaagcatca       300
     tctgatgggc aaaacacctc ttcacgtctt gcgattcaaa aagatatcag ccgtttgatg       360
     gaagagctta acaccattgc aaaaactacc tctttcaacg gtcagaaact cctctccgga       420
     tcgtttacca ataaaactat ccaaatgggt gccagctcaa acgaaggggt caacttttcg       480
     gttgcttcaa cagagccgaa taaaatcggt cataccagcc gtgctcaatt gaacctcgct       540
     tcggaagtgg gaagtgtgca attgacgatg aaaagtgcct tgacgggtga aaacatcacg       600
     atgaaagcaa tcgatattca atacaataat acaccggaaa acggtatggg tgcattggcc       660
     gatgagatca actcccacag cggtattacc ggtatccgtg ccaaagcggt cgttgaagta       720
     acctctggaa gtgcgattgc ggcgggtact acaggatcgg gatttgcgat taacggaatc       780
     aacatcgggg cgatcaatgt caaagccaat gacggcgacg gcgcattgat ggcggcgatc       840
     aatggcaaaa ccacccaaac gggtgttgcg gcaacgatca ccgatgatgg aaaaataacc       900
     ctcaaagcaa ccgacggtcg tgcgatcaaa gtagagggga atgtgagtga cgtcttcggc       960
     ggaacggcga atcagctctc tacggtcgga tacatcgaac tggttcaaaa aggggcggca      1020
     gagttccaag tcagcggtat cggtgccggt gccgtcggag ggacgatcaa cctctcaggg      1080
     gctaccagta tggttaaaga ctcaatcctt gcggctggct cttcgatcgc cgtcggttcg      1140
     acgttgaaag tgggaaccac catcggggga gatgttaact tgactgcagc taccacgttg      1200
     gtcttggacg gaaccctcaa agcgggaacg accgcagcag cgggaacgac atttgccaaa      1260
     gggaccacaa tgggagccgc tgttaatcta acggctgccg tagctctttc ggccgatatg      1320
     tatatcacgg ccggttctac cctcgtaagc ggtacgattt ttgatgcagg tacgttagta      1380
     caacaagact ttaccgtcaa cggcgtgacg taccacaaag gggatgttct ctcttcggac      1440
     gttacgttga cggcatcctt aacccttacc tctgatatga cgatcaacgt cgatctcagc      1500
     ggtactgcca actcctctat tgccacagca tcgaccatca acgtcggttc ggtactcggc      1560
     ggtaacattg tcagcagttc caccgctacc gtatcggaag atatgacgct caaatcggga      1620
     tcaattcttg cggccgcttc caaactcaaa gcgggatcgg tgctcggtgc cgatacggtc      1680
     aactcatccg ccgttacaac ctatacaacg actgatttga aagcgggaag ctctttggcc      1740
     gccgcaagta cgctcaaaga gggttcaacg atcgggggga cggtcatcaa ctcatccgcc      1800
     attaccctca atgcggatat gacgatcaaa gcgggttcaa ccctcgcaac cggtaccgtg      1860
     atcaaagcgg gaaccgttct gatgcaagat cttactgccg ctcaaaccgg tgcttcagca      1920
     atgagtgcgg gggataaagt aacggtcgat atcacgaccg gtgcggctat caccctctct      1980
     gcagatttga cattgcttcg cggaacaggt acggctccga ccatcgctgc cggatcaacg      2040
     ttgatgccga atacggagaa ctccggtcgg gttggaatcg atgcgggcga ggtgacgaac      2100
     ctctccagta tcagcgtcct caatctcaca gatgccatga aagcgatcga tactctcgat      2160
     gccgctatcg gggatctcga tacgatccgc gcagacctcg gttcggttca aaaccagttg      2220
     acggctacaa ttaacaacat cagcgtgact caagttaacg ttaaagcggc ggaatcacaa      2280
     ctccgtgatg tcgatttcgc ggcagagagt gcaaacttct ctaaatttaa catccttgca      2340
     caatcaggaa gctatgcgat gagccaagcc aacgctgtgc agcaaaacgt tttaaaactc      2400
     ctccaataa                                                              2409
//

If you have problems or comments...

PBIL Back to PBIL home page