(data stored in ACNUC7421 zone)

EMBL: CP002355.PE164

CP002355.PE164       Location/Qualifiers
FT   CDS_pept        complement(170830..173238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0165"
FT                   /product="flagellin domain protein"
FT                   /note="COGs: COG1344 Flagellin and related hook-associated
FT                   protein; InterPro IPR001492: IPR010810: IPR001029; KEGG:
FT                   dat:HRM2_36880 putative flagellin; PFAM: flagellin domain
FT                   protein; flagellin hook IN repeat protein; SPTR: Putative
FT                   flagellin; PFAM: Bacterial flagellin N-terminal helical
FT                   region; Flagellin hook IN motif; Bacterial flagellin
FT                   C-terminal helical region"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32832"
FT                   /db_xref="GOA:E4TXD5"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD5"
FT                   /protein_id="ADR32832.1"
FT                   /translation="MGFRINTNISAMNAHSNSVMNNRNLDESLSKLSSGLRINKAADDA
FT                   SGMVIANALRNQANSLGQAISNGNDGIGLIQTADGALNEYSKILDTIKTKAVQASSDGQ
FT                   NTSSRLAIQKDINRLMEELNTIAKTTSFNGQKLLSGSFTNKTIQMGASSNEGVNFSVAS
FT                   AETNKIGHTSRATLNLASEVGSVQLTMKSALTGENITMKAIDIQYNNTPENGMGALADE
FT                   INSHSGITGIRAKAVVEVTSGSAIAAGATGTDFTINGINIGAINTKANDGDGALMAAIN
FT                   AKTAQTGVAATITDDGKMTLKSTDGRAIKVQGNVGDVFGGTANQLSTVGYIELVQKGAA
FT                   EFQVSGIGAGAVGGTINLSGATSMVKDSILAAGSSIAVGSTLKVGTTIGGDVNLSAATT
FT                   LVLDGTLKAGTTLLSATTFAKGTTTGAAFNTSAAVALSSDMFITAGSTLVSGSILDSGT
FT                   VVQQDFTVNGVTYSKGDTLTSDVTLTASLTLTSDMTINVDLSGTANSSIAAASTINVGS
FT                   VLGGNLVSSSSATVSEDMTLKSGSIIAAASKLKAGSVLGADTVNSSAVTTYTTTDLKAG
FT                   SSLAAASTLKEGSTIGGTVINSSAITLNSDMTIKAGSTLATGTVIKAGTVLTQDLTAAQ
FT                   TGAAAMSAGDKVTVDITTGAAITLSEDMTLLRGDGTAPTIAAGSTFMPNTENSGSVGID
FT                   AGEVTNLSSVSVLNLTDAMKAIDTLDAAIGDLDTIRADLGSVQNQLTATINNISVTQVN
FT                   VKAAESQLRDVDFAAESANFSKFNILAQSGSYAMSQANAVQQNVLRLLQ"
     atgggtttca gaattaatac taacatttcg gcgatgaacg ctcacagtaa tagcgtaatg        60
     aacaatcgta atttggacga gtctctctcc aaactcagtt caggtcttcg tattaacaaa       120
     gccgcagacg atgcatcagg gatggttatt gccaatgcgc ttcgtaacca agcaaattct       180
     ctgggacaag cgatctctaa tggtaacgac ggtattggtt tgatccaaac ggcggatggt       240
     gcactcaacg agtactcaaa aatcctcgac accattaaaa ccaaagcagt tcaagcatca       300
     tctgatgggc aaaacacctc ttcacgtctt gcgattcaaa aagatatcaa ccgtttgatg       360
     gaagagctta acaccattgc aaaaactacc tctttcaacg gtcagaaact cctctccgga       420
     tcgtttacca ataaaactat ccaaatgggt gccagctcaa acgaaggggt taacttttcg       480
     gttgcttctg cagagactaa taaaatcggt cataccagcc gtgcgacatt gaacctcgct       540
     tcggaagtgg gaagtgtgca attgacgatg aaaagtgcct tgacgggtga aaacatcacg       600
     atgaaagcaa tcgatattca atacaataat acaccggaaa acggtatggg tgcattggcc       660
     gatgagatca actcccacag cggtattacc ggtatccgtg ccaaagcggt cgttgaagta       720
     acctctggaa gtgcgattgc agcgggtgct acgggaaccg atttcactat caacggaatc       780
     aacatcggag caatcaatac taaagccaat gacggcgacg gcgcattgat ggcggcgatc       840
     aacgcgaaaa ccgcccaaac gggtgttgcg gcaacgatca ccgatgatgg aaaaatgacc       900
     ctcaaatcaa ccgacggtcg tgcgatcaaa gtacagggga acgtcggtga cgtcttcggc       960
     ggaacggcga atcagctctc tacggtcgga tacatcgaac tggttcaaaa aggggcggca      1020
     gagtttcaag tcagcggtat cggtgccggt gccgtcggag ggacgatcaa cctctcaggg      1080
     gctaccagta tggttaaaga ctcaatcctt gcggctggct cttcgatcgc cgtcggttcg      1140
     acgttgaaag tgggaaccac catcggggga gatgttaact tgtctgcagc taccacgttg      1200
     gtcttggacg gaaccctcaa agcggggaca acccttctat cggcaacgac atttgccaaa      1260
     gggaccacaa cgggagccgc tttcaatacg tcagctgccg tagcgctttc atcggatatg      1320
     ttcatcacgg ccggttctac cctcgtaagc ggttctatcc ttgactcagg aaccgtagta      1380
     caacaagact ttaccgtcaa cggcgtaacg tacagcaaag gggatactct cacttcggac      1440
     gttacgttga cggcatcctt aacccttacc tctgatatga cgatcaacgt cgatctcagc      1500
     ggtactgcca actcttccat tgccgcagcg tcgaccatca acgtcggttc ggtactcggc      1560
     ggtaaccttg tcagcagttc gagtgcaacc gtatcggaag atatgacgct caaatcggga      1620
     tcaattattg cggccgcttc caaactcaaa gcgggatcgg tactcggtgc cgatacggtc      1680
     aactcatccg ccgttacaac ctatacaacg actgatttga aagcgggaag ctctttggcc      1740
     gccgcaagta cgctcaaaga gggttcaacg atcgggggga cggtcatcaa ctcatccgcc      1800
     attaccctca attcggatat gacgatcaaa gcgggttcaa ccctcgcaac cggtaccgtg      1860
     atcaaagcgg gaaccgttct gactcaggat cttaccgccg ctcaaaccgg tgcagcagca      1920
     atgagtgcgg gggataaagt aacggtcgat atcacgaccg gtgcagctat caccctctct      1980
     gaagatatga cattgcttcg cggagatggt acggctccga ccatcgctgc cggatcaacc      2040
     tttatgccga atacggagaa ctccggtagt gtcggaatcg atgcgggcga ggtgacgaac      2100
     ctctccagtg tcagcgtcct caatctcaca gatgccatga aagcgatcga tactctcgat      2160
     gccgctatcg gggatctcga tacgatccgc gcagacctcg gttcggttca aaaccagttg      2220
     acggctacaa ttaacaacat cagcgtgact caagttaacg ttaaagcggc ggaatcacaa      2280
     ctccgtgatg tcgatttcgc ggcagagagt gcaaacttct ctaaatttaa catccttgca      2340
     caatcaggaa gctatgcgat gagccaagcc aatgctgtgc agcaaaacgt attgagattg      2400
     ttacaatag                                                              2409
//

If you have problems or comments...

PBIL Back to PBIL home page