(data stored in ACNUC7421 zone)

EMBL: CP002355.PE165

CP002355.PE165       Location/Qualifiers
FT   CDS_pept        complement(173337..174002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0166"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; KEGG: glo:Glov_0968 hypothetical
FT                   protein; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32833"
FT                   /db_xref="GOA:E4TXD6"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD6"
FT                   /protein_id="ADR32833.1"
FT                   /translation="MRQGFMLIEVMLAIVMAGILAAVLATMGYYTVIQGNTLKQQNSKT
FT                   MLEVIRSRLLNTASNPDNDAYFELLKEVNATVPVVIGLGKDAWGRNISYTTYDFGTHNT
FT                   NATYADNNTTSISPNANVLGRLLSRGEDGILQTNATHSSAQGDDILLEIGIGETNHMKL
FT                   YNGSEVSTQTRGYNSAIVALSTDPYPASPINGTILFLRDTNVTKIYDSNTSDWIQISP"
     atgagacaag gatttatgct tatcgaagta atgcttgcca ttgtcatggc aggaattttg        60
     gcagcagtac tggcgactat gggatattac acagttattc aaggcaatac tctaaaacag       120
     caaaacagca aaacgatgct tgaagtgatc cgaagccgat tactcaatac tgcttcaaat       180
     ccggataatg atgcctattt tgaactacta aaagaggtaa atgctaccgt tccggttgtg       240
     attggtttgg ggaaagacgc atggggtcgt aatatcagct acacgaccta cgattttggt       300
     acccataata caaacgccac ttatgccgat aataatacga catccatctc tcccaatgca       360
     aatgtactcg gccgtctcct cagccgaggg gaagacggta ttttacaaac caatgcgacc       420
     cattcgagtg ctcagggtga tgatatactg ctcgaaatcg ggatcggtga aaccaaccat       480
     atgaaactct ataacggttc ggaagtctcc acacagaccc gcggatacaa cagcgcaatc       540
     gtcgcccttt caaccgaccc ctatccggct tcgcctatta acggaaccat tttatttcta       600
     cgcgatacca acgtaaccaa aatttacgat tccaatacat ccgactggat tcaaatttct       660
     ccctaa                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page