(data stored in ACNUC7421 zone)

EMBL: CP002355.PE166

CP002355.PE166       Location/Qualifiers
FT   CDS_pept        complement(174003..175043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0167"
FT                   /product="Type II secretion system F domain"
FT                   /note="COGs: COG1459 Type II secretory pathway component
FT                   PulF; InterPro IPR018076; KEGG: dat:HRM2_22330 PilC; PFAM:
FT                   Type II secretion system F domain; SPTR: Type II secretion
FT                   system protein; PFAM: Bacterial type II secretion system
FT                   protein F domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32834"
FT                   /db_xref="GOA:E4TXD7"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD7"
FT                   /protein_id="ADR32834.1"
FT                   /translation="MKPDVLTLLKALQLSLENGKSLTNALNLLQNTAKDKDERAIYINI
FT                   TRSIQEGASFSNAIEKYISPSPDIIQFVAMAEKGGGFVKTLKSVVNYLEIKNRFHQESN
FT                   DKIALPVIYFTLTAIIIIFIRFFAVPFHISEAKSYDPRIYAIIAEHLDMALILSNLLLG
FT                   GLLFFSAYFLIVMIALFNYSGAIQGVAKRIASHLPISSLVIGYFEKFILLSLLSEMLKN
FT                   GVSLKMTFKTAANSTIIPRISKQFEGILAQVSRGEKNFWSIPFFEEIEQHLLAGAGTVA
FT                   QLGNMFGEFADRARFNALTMASKFFRSMTIVAILLLSFAVFVEFFTIVLTQVLIQQGII
FT                   DQVGHA"
     atgaaacctg atgtactcac cctcttaaag gcgctgcagt tatctttgga aaatggaaag        60
     agccttacta atgcactcaa tttacttcaa aatacggcaa aagacaagga cgaacgcgcc       120
     atatacatca atattacccg ctcaatccaa gaaggagcct ctttttccaa tgcgatagag       180
     aaatacatat ccccttcccc cgatatcatc cagtttgttg ctatggcaga aaaagggggt       240
     ggattcgtca aaacgctcaa atcggttgta aattatctag agataaaaaa ccgatttcat       300
     caagagtcaa acgacaaaat tgcccttcct gtcatctatt ttacgttgac ggcaatcatc       360
     attattttca tccgtttttt tgctgttccg tttcacatca gtgaagccaa aagctacgat       420
     ccgagaatct acgctattat cgctgaacat ttggatatgg ctcttattct aagcaatctt       480
     ctattaggag gattgctttt cttttcggcc tattttctta tcgttatgat cgcccttttt       540
     aactatagtg gagccattca aggcgtggcg aaacggatag cgtcgcacct gccgatctct       600
     tctctcgtta tcggttattt tgaaaaattc atcctactga gtctgctcag cgaaatgctt       660
     aaaaatggcg tttcgttaaa aatgaccttt aaaaccgccg caaacagcac cattattcct       720
     cgcatatcaa agcaattcga ggggattctt gcccaagtga gccgaggcga aaaaaacttt       780
     tggagtatcc cctttttcga agagatcgaa cagcacctcc tcgccggagc gggaacagta       840
     gctcaactgg gcaatatgtt tggtgaattt gcggaccggg ccagatttaa tgcactcact       900
     atggcgagta agttttttcg cagtatgacg atagtggcta ttttactact gtcgtttgcc       960
     gtatttgtcg aatttttcac catcgtcttg actcaggtat taatccaaca agggatcatc      1020
     gatcaagtag gacatgcata a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page