(data stored in ACNUC7421 zone)

EMBL: CP002355.PE167

CP002355.PE167       Location/Qualifiers
FT   CDS_pept        complement(175033..176595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0168"
FT                   /product="type II secretion system protein E"
FT                   /note="COGs: COG2804 Type II secretory pathway ATPase
FT                   PulE/Tfp pilus assembly pathway ATPase PilB; InterPro
FT                   IPR001482: IPR003593; KEGG: nam:NAMH_1148 type II secretion
FT                   system protein E; PFAM: type II secretion system protein E;
FT                   SMART: AAA ATPase; SPTR: Type II secretion system protein
FT                   E; PFAM: Type II/IV secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32835"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXD8"
FT                   /protein_id="ADR32835.1"
FT                   /translation="MNIKKILTSKQLEVCQKEQYYYQQIGIKKHLLDIALSHHFIQKKE
FT                   TSKTYNLELMKEYEMIIADERDDTLTILRKELLGEKRLAELSGKVHKKIEQKNIPVREF
FT                   QQKYTSLLRVDPESIERKIKQFNAMDDGENEVIDIFEMLLEYGIQRSASDIHINAYESF
FT                   YWLRYRIDGKIIARYLLNHELAQRFALIIKERCNIDMINVYAPQGGSFSREYENRTIDF
FT                   RIEIAPSQYGENIVLRILDKASNIKSLNSLFPKSHPMSEHLHHFVNQSSGFFLVVGPTG
FT                   SGKTTTLNAILNQRDRLHEIIYTIEDPIEYKIDFVTQYQINEASGFTFAEGMKSIMRQD
FT                   PDVIVIGEMRDRESILTGLKAAHSGHMVFSTLHTPNSFMAMERIRDEGGDLFILAYSLS
FT                   GVVAQRLIPKLCSCKQPCGVEDGKAFFSTETYGFEKSGCIRCNFTGYSGRALLLDMVFI
FT                   PGDMKIRYQFYLALKNSTVFKAWEHFITFSYFQSAAYLFEMGTCDYETLSSELLSLGYV
FT                   HET"
     atgaatatta aaaagatatt gacgtcgaaa cagctggaag tatgccaaaa agagcaatac        60
     tattatcagc aaatcggcat taaaaagcat cttctcgata ttgcactctc tcaccacttc       120
     atccaaaaaa aagagacctc aaaaacctat aatctcgaac tcatgaaaga atacgaaatg       180
     attatcgccg acgaacgcga tgacaccctc acaattcttc gaaaagagct tttaggggaa       240
     aaacgtcttg ccgaactcag cggaaaagtc cataaaaaaa tcgagcaaaa aaatatcccc       300
     gttcgtgagt ttcaacaaaa atatacgtct cttctgcgcg tcgatcccga gagtattgag       360
     cgaaaaatca agcagtttaa tgcgatggat gacggagaaa atgaagtcat cgatattttt       420
     gaaatgcttc tggaatacgg tattcaacgt tccgccagtg atatccatat caatgcctac       480
     gaatcgtttt attggctccg ctaccgcatc gacggaaaaa tcatagcccg atacctcctc       540
     aatcatgagt tggcgcaacg ttttgctctg attatcaaag agcgctgcaa catcgatatg       600
     attaatgtct atgcccctca ggggggaagt ttctcccgcg aatacgaaaa ccgcaccatc       660
     gattttcgta ttgaaattgc cccgtcgcag tatggagaaa atatcgtttt gcgtattttg       720
     gacaaagcga gcaatatcaa atcgcttaac tccctcttcc ctaaaagcca ccctatgtcg       780
     gaacaccttc accatttcgt caaccagtcc agcggctttt ttctcgtcgt aggaccgacc       840
     ggaagcggga aaacaacaac gctcaacgcc attttaaatc agcgggacag actccacgaa       900
     atcatctata cgattgaaga tccgatcgag tataaaatcg acttcgttac ccagtatcag       960
     atcaacgagg caagcggctt tacctttgcg gaggggatga aatcgatcat gcgtcaagac      1020
     cctgacgtca ttgttatcgg ggaaatgcgg gatcgcgaat cgattctcac cggacttaaa      1080
     gcggcgcaca gcggacacat ggttttctct acactccata cacccaacag ttttatggcg      1140
     atggaacgta tccgtgatga ggggggggat ctctttatcc tcgcctattc actcagcgga      1200
     gttgtagctc aacggcttat tcctaaactc tgctcgtgta aacaaccctg cggcgttgaa      1260
     gacggaaaag cattttttag caccgaaacg tatgggtttg aaaaaagcgg ctgtatccga      1320
     tgcaatttta ctggatacag tggtcgggca ttattgctgg atatggtttt tatccccgga      1380
     gatatgaaaa tacgctacca attttatctt gcccttaaaa acagcaccgt ctttaaagca      1440
     tgggaacact tcatcacgtt tagctatttc caatcggctg cgtatttatt cgagatgggg      1500
     acatgtgatt atgaaacgct ctctagcgaa ttgctatcgt taggatacgt ccatgaaacc      1560
     tga                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page