(data stored in ACNUC7421 zone)

EMBL: CP002355.PE169

CP002355.PE169       Location/Qualifiers
FT   CDS_pept        complement(177133..177726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0170"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001120: IPR012902; KEGG:
FT                   vha:VIBHAR_03468 Tfp pilus assembly protein major pilin
FT                   PilA; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32837"
FT                   /db_xref="GOA:E4TXE0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE0"
FT                   /protein_id="ADR32837.1"
FT                   /translation="MTIYKNHRKGISLVEMTIAVILFGVLSTVTMLYYKNLFNIDLTSK
FT                   KARIAALMDQGRQLSGAYDVYIAQFGIAPLDVNLSDFNATNVMILKHLPKDIIEMTTVG
FT                   WELNTSAVDGHPAFQFPIDLNGTSYKLAGVKDDDQYCAIFNHEINTSLDLNVSDNMNFG
FT                   TAASQYSALGDAFCYTEILGANDHKHWIMIVQQN"
     atgactatct ataaaaatca cagaaaaggt atctctctcg ttgaaatgac gattgccgtt        60
     atcttgtttg gtgttttatc aaccgttaca atgctgtatt acaaaaatct tttcaacatt       120
     gatttaacgt ctaaaaaagc acgtattgca gctttgatgg atcaaggcag acaactctca       180
     ggtgcgtatg atgtttatat agcgcagttc ggtattgccc cattggatgt caatttgtcc       240
     gattttaacg caactaatgt catgatcctt aagcatcttc ctaaagatat catcgaaatg       300
     accacagtag gatgggagct gaatacttca gcagttgacg gacatcctgc atttcagttt       360
     cctattgact tgaatggtac ctcttataaa ctggccggtg tcaaagatga tgatcagtat       420
     tgtgctatct tcaaccatga aatcaataca agtttggatt taaatgtctc cgacaacatg       480
     aatttcggaa cagcagccag ccaatattcc gccctcggag atgcattttg ctataccgaa       540
     atacttggag ccaatgatca caaacattgg attatgatcg ttcaacaaaa ttaa             594
//

If you have problems or comments...

PBIL Back to PBIL home page