(data stored in ACNUC7421 zone)

EMBL: CP002355.PE17

CP002355.PE17        Location/Qualifiers
FT   CDS_pept        complement(18372..18806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0017"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="InterPro IPR012312; KEGG: tdn:Suden_0493 hemerythrin
FT                   HHE cation binding region; PFAM: Hemerythrin HHE cation
FT                   binding domain protein; SPTR: Hemerythrin HHE cation
FT                   binding region; PFAM: Hemerythrin HHE cation binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32685"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW69"
FT                   /protein_id="ADR32685.1"
FT                   /translation="MILEFMRDDHRACDHYYTEAENALSEKKVDDAVRLFDEFYRATNH
FT                   HFDMEERELFITFEKRTGMTGGPTQMMRYEHQQLRSLLESMKSALNEKRYNDFFGIGES
FT                   MMIMLQQHNMKEEQMLYPMIDRALGSDSEHMIQILKDMGQ"
     atgattttag aatttatgcg tgacgatcac cgtgcgtgcg atcattatta cacagaagcc        60
     gaaaatgccc taagcgaaaa aaaagtcgat gatgcggtca gattattcga cgaattttac       120
     cgagccacca atcatcactt cgatatggaa gaacgcgaac tttttattac cttcgaaaaa       180
     cggaccggga tgacgggggg accgacgcag atgatgcgct atgagcatca gcagctgcga       240
     agtcttttgg aatcgatgaa aagtgcgttg aatgaaaagc gctataatga ttttttcggt       300
     atcggcgaat ccatgatgat tatgcttcag cagcacaata tgaaagagga acagatgctc       360
     tatccgatga tcgaccgcgc attgggaagc gattctgagc atatgattca aatcctaaag       420
     gatatggggc aatga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page