(data stored in ACNUC7421 zone)

EMBL: CP002355.PE170

CP002355.PE170       Location/Qualifiers
FT   CDS_pept        complement(177843..178448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0171"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001120: IPR012902; KEGG:
FT                   vha:VIBHAR_03468 Tfp pilus assembly protein major pilin
FT                   PilA; SPTR: Putative uncharacterized protein; TIGRFAM:
FT                   prepilin-type N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32838"
FT                   /db_xref="GOA:E4TXE1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE1"
FT                   /protein_id="ADR32838.1"
FT                   /translation="MRNIYKSHRKGISLIEMIIAVILFGVLSAIGVKYYKNFFNTDLTA
FT                   KKARVAALLDQAAQMSNAYDAYIAQVGSVASLDINLTELDDANVSILSRLPVAITELAS
FT                   GNADGTGGWELNNTTGIAGTSGIALQYKLDKNATGRLNTSDDEQYCAIINHEFNASVEY
FT                   NASNATAFHTNPTIAYQNLGPVFCWNNGSHLTLFIVKP"
     atgcgtaata tctacaaaag tcatcgaaaa ggtatctctc tcattgagat gattattgct        60
     gttatcttat ttggagttct ctccgctatc ggggttaaat actacaaaaa cttttttaat       120
     acggacttga cggctaaaaa agcacgtgta gcggcacttt tggatcaagc ggcacaaatg       180
     tcgaatgcgt atgacgcata cattgcgcaa gtaggttcgg tcgcaagcct tgatatcaac       240
     cttaccgaac tcgatgacgc gaacgtttcg atccttagcc gccttccggt agctattacg       300
     gaattggcct caggaaatgc ggacggcacc ggcggctggg aattaaacaa cactaccggc       360
     attgcgggga caagcggaat cgcgcttcag tacaaactgg ataaaaatgc taccggacgc       420
     ttgaacactt cagatgatga gcaatattgt gcgattatca accatgagtt caatgcaagt       480
     gtcgaataca atgcgtctaa tgcaactgca ttccatacca atccaaccat cgcgtatcaa       540
     aatttaggtc cggtattctg ctggaacaac ggatcgcacc taacactctt tatagttaaa       600
     ccttaa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page