(data stored in ACNUC7421 zone)

EMBL: CP002355.PE171

CP002355.PE171       Location/Qualifiers
FT   CDS_pept        complement(178605..179207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0172"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001120: IPR012902; KEGG: emi:Emin_1442
FT                   Tfp pilus assembly protein major pilin PilA-like protein;
FT                   SPTR: Tfp pilus assembly protein major pilin PilA-like
FT                   protein; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32839"
FT                   /db_xref="GOA:E4TXE2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE2"
FT                   /protein_id="ADR32839.1"
FT                   /translation="MKQYTGMRKGISLIEMIVAVILFGVLSAIGVKYYKNFFNTELTAK
FT                   KARVAALLDQASQMSNAYDAYIVQVGSIANLDTNLTQLDDANVSILSRLPIAITELASG
FT                   NVDGTGGWELNKTTGISGTTGIALQYKLDKNATGRLNTSDDEQYCAIINHEFNASIEYN
FT                   ASNATVFPVSATSAYQRFGQVFCWNNGTHLTLFVVKP"
     atgaaacagt acacaggaat gagaaaaggt atctctctta ttgagatgat tgttgccgtt        60
     attttatttg gagttctctc cgctatcgga gttaaatact ataaaaactt ctttaatacg       120
     gagttaacgg ctaaaaaagc acgtgtagcg gcacttttgg atcaagcatc acaaatgtcg       180
     aatgcgtatg acgcatacat tgtacaagtg ggttcaatcg cgaaccttga taccaacctt       240
     acccagcttg atgacgcgaa cgtttcgatc cttagccgtc ttccaatcgc tattaccgaa       300
     ttggcttcag gaaatgtgga cggcaccggc ggttgggaat tgaacaaaac taccggtatt       360
     tctggtacaa caggtatcgc acttcaatac aaactggata aaaatgctac cggacgcttg       420
     aacacttcag atgatgagca atattgtgcg attattaacc atgagttcaa tgcaagtatc       480
     gaatacaatg cgtctaatgc aaccgtattc cctgttagtg caacaagtgc ttaccaacgt       540
     ttcggacaag tattctgctg gaacaacgga acacacctta cgctcttcgt agttaaacct       600
     taa                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page