(data stored in ACNUC7421 zone)

EMBL: CP002355.PE172

CP002355.PE172       Location/Qualifiers
FT   CDS_pept        complement(179250..179693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apr:Apre_1080 dihydroxyacetone kinase, DhaK
FT                   subunit; SPTR: Bacteriophage N4 receptor, outer membrane
FT                   protein; manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32840"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE3"
FT                   /protein_id="ADR32840.1"
FT                   /translation="MKKYSLLGLFVVILLTILVSTYFYFLDIVYEDKTVAEEVKTFSAL
FT                   KTAVEQPVAVYAEQDVLRTKNDQYDAMLQELGMDAEVKIDQKKLTIQGGIHDTYSYLLL
FT                   KRLLDVVKNDDVELVSSCIGQGCTGDEFGFSITIRPYVLKIPQ"
     atgaaaaaat atagtctctt gggtctattt gttgttattt tattaacaat tttagtctca        60
     acatactttt attttctcga tattgtatac gaagacaaaa cggtagccga agaggtaaaa       120
     acctttagtg ctttaaaaac tgccgttgag cagccagttg ctgtgtacgc agaacaagat       180
     gttctgcgta ctaaaaatga tcaatacgac gctatgctcc aggaattggg gatggacgcc       240
     gaagtaaaga tcgaccaaaa aaaattaact attcaaggag gcattcatga cacctattca       300
     tacctactat tgaaacggct cttggatgtt gtcaaaaatg atgacgttga attagtcagc       360
     agctgcatcg gtcaaggatg cacgggggat gaattcggat tttcaatcac aattcgtccc       420
     tatgtgttaa agattccaca ataa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page