(data stored in ACNUC7421 zone)

EMBL: CP002355.PE173

CP002355.PE173       Location/Qualifiers
FT   CDS_pept        complement(179680..180474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vvu:VV2_1341 Mg-dependent DNase; SPTR:
FT                   Putative group-specific protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32841"
FT                   /db_xref="GOA:E4TXE4"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE4"
FT                   /protein_id="ADR32841.1"
FT                   /translation="MAIFTAGSISLTNDISNIRTQVYNYARQDLDSSAVKVSLRKHSEG
FT                   INYIAFLPKEKLVYENILLLASKNQGKSVIIFELDYKNVGVVVEDDKIIDYILDKPEDF
FT                   ATERGYGTLYADNTKGDKLVSINLDKERKDTWVGSFLLACTIVVTSGILYAGYGYLNAT
FT                   EINITNRDTLVKEYKELVTKNCQTSFAMTKKVDIVHELEKIENLTKETESTLQQISYQN
FT                   DSLCAEVVTPNLNAFVRLLPPEAKIIKEDVAQGIVQYCNEKI"
     atggcaatct ttacagcagg atctatcagt ttaaccaatg atatcagcaa tatccgcacg        60
     caggtctaca actatgcgcg tcaggatctt gattcttcag cggtcaaagt ttcattacga       120
     aagcactcgg aggggatcaa ctatatcgca tttcttccga aagagaagct cgtttatgaa       180
     aacatccttc tccttgcttc aaagaaccaa ggaaaaagtg tgatcatttt tgaactggac       240
     tataaaaatg tcggtgtagt cgtcgaagac gacaaaatta ttgattatat cctcgataaa       300
     cccgaagatt ttgcgacaga acgcggttat ggaactcttt atgctgataa cacgaaaggg       360
     gataagcttg tctctatcaa tctggataag gagcggaaag atacctgggt cggaagcttt       420
     ttgctggcgt gtaccatcgt agtaacctca ggaattttgt atgccggata cggctatctc       480
     aatgcgactg aaattaacat aaccaacaga gatacactcg ttaaagagta caaagagctg       540
     gtgactaaaa attgccaaac ctcgtttgca atgaccaaaa aagtagatat tgtccatgaa       600
     ttggaaaaaa ttgaaaatct tacgaaagag acggagtcca cccttcagca gataagctat       660
     caaaacgata gcttatgtgc tgaggtggtg acaccaaacc tcaacgcttt tgtcaggttg       720
     ttaccaccgg aagcgaaaat tataaaggaa gacgttgctc agggcatcgt gcaatattgt       780
     aatgaaaaaa tatag                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page