(data stored in ACNUC7421 zone)

EMBL: CP002355.PE175

CP002355.PE175       Location/Qualifiers
FT   CDS_pept        complement(181922..182311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0176"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: geo:Geob_2647 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32843"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE6"
FT                   /protein_id="ADR32843.1"
FT                   /translation="MNYFWSFLFLALSLNAAYNPFFREPVKPKKAPVATSDARPMPLPP
FT                   LLAPPSLPSKTEFDLSQLIYNCFLETNKGKFILLKIGENTVVLKEGDPFYANNHKYFIR
FT                   NITSNYITVDDAGRIQTIYFTTGAN"
     atgaactatt tttggtcatt tctttttctt gcactatcgc taaatgcggc ctataacccg        60
     tttttccgtg aacctgtaaa gccgaagaaa gctcctgtag caacatcaga tgcacgtcct       120
     atgcctctgc cgccactgtt agcgccccct tcattaccgt ctaaaacgga atttgatctt       180
     tctcaactca tctataactg ttttttagag accaataaag ggaaattcat acttcttaaa       240
     attggagaga acaccgttgt tctaaaagag ggagaccctt tttatgcaaa caaccacaaa       300
     tattttatcc gcaatatcac cagcaattat atcactgttg atgatgccgg tcgaatccaa       360
     accatctatt tcacgacagg agcaaattaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page