(data stored in ACNUC7421 zone)

EMBL: CP002355.PE176

CP002355.PE176       Location/Qualifiers
FT   CDS_pept        182477..183022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0177"
FT                   /product="Peptidase M15A"
FT                   /note="COGs: COG3108 conserved hypothetical protein;
FT                   InterPro IPR013230; KEGG: rpf:Rpic12D_5086 protein of
FT                   unknown function DUF882; PFAM: Peptidase M15A; SPTR:
FT                   Putative uncharacterized protein; PFAM: Bacterial protein
FT                   of unknown function (DUF882)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32844"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE7"
FT                   /protein_id="ADR32844.1"
FT                   /translation="MEIKRLESPLLNPSRRTFIKNVIALSASTSLFADNKEKDEILSVI
FT                   RNGTSYKIPFIRDGKIEENGYDDLCRVFADVRAGVAVRMDPNLFLILTKAQQWLSSNHI
FT                   NRPIILTSGYRTEHTNSITEGAAFNSMHLYGKAADIKIEGIPADYLARLLRMCGGAGIG
FT                   IYPTFVHVDTWRERAWRG"
     atggaaatca aacgattaga atctccgctc ttgaatccgt cgagaagaac atttataaaa        60
     aatgtgatag ctttatcggc ttcaacatcg ctttttgccg ataataaaga gaaagacgaa       120
     attctcagtg ttatccgcaa cggtacttcc tataaaattc cgtttattcg cgatggcaaa       180
     atagaagaaa acggctatga tgatttatgc cgtgtttttg ccgatgttcg tgccggagta       240
     gctgtaagaa tggatccgaa tttatttttg attttgacaa aagcccaaca atggctgtca       300
     agcaatcata ttaatcgccc tattattctg acatccggtt atcgtacgga acacacgaat       360
     agtataacgg agggagcagc ctttaattcg atgcatttgt acggcaaagc tgccgatata       420
     aaaatcgaag gcattcctgc agattattta gcgaggctgc ttaggatgtg cggcggagcc       480
     ggaataggaa tatacccgac cttcgtccat gtagatacgt ggagagaacg ggcatggaga       540
     ggttag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page