(data stored in ACNUC7421 zone)

EMBL: CP002355.PE177

CP002355.PE177       Location/Qualifiers
FT   CDS_pept        183109..185331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0178"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.6.2.2"
FT                   /note="COGs: COG0550 Topoisomerase IA; InterProIPR000380:
FT                   IPR005733: IPR006171: IPR013497: IPR 013498: IPR006154:
FT                   IPR003601: IPR003602; KEGG: tdn:Suden_0171 DNA
FT                   topoisomerase I; PFAM: DNA topoisomerase type IA central
FT                   domain protein; TOPRIM domain-containing protein; DNA
FT                   topoisomerase type IA zn finger domain protein; PRIAM: DNA
FT                   topoisomerase; SMART: DNA topoisomerase I DNA-binding; DNA
FT                   topoisomerase I ATP-binding; Toprim sub domain-containing
FT                   protein; SPTR: DNA topoisomerase; TIGRFAM: DNA
FT                   topoisomerase I; PFAM: Toprim domain; Topoisomerase DNA
FT                   binding C4 zinc finger; DNA topoisomerase; TIGRFAM: DNA
FT                   topoisomerase I, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32845"
FT                   /db_xref="GOA:E4TXE8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXE8"
FT                   /protein_id="ADR32845.1"
FT                   /translation="MKLIIVESPAKAKTIKNFLSKDYEVIASKGHIRDLPKNRFGIKID
FT                   DEKIIAEYRISEDSTATVKQIQELAKKSDTIYIATDEDREGEAIGWHIAHAIDKDPSSL
FT                   PRIVFHEITKNAIIHALETPRTIDMDRVNAQQARRLLDRIVGYKLSPLLANKIQKGLSA
FT                   GRVQSSTLKIVVDREREIRAFIPEEYWTIDTLFKKDIEAALVNFENEKIDKLTIKTGDE
FT                   AARIVETLKGESFKVGEIETKERKSSTPPPFMTSTLQQTASSQLGFSPKKTMMVAQALY
FT                   EGVKTPEGTSGVITYMRTDSLNLATEAVEAAREVILTRYGKEYLPKEAKVYTKKSKGAQ
FT                   EAHEAIRPTMLGFTPEVAATYLKPDEIKLYRLIYNRFLACQMNDARFEQQSITFESAKA
FT                   QFRATGRKLLFDGFYRVTGSDDKDKLLPSLTTGDSIEIQTVTPEQHFTEPPARYSEASL
FT                   IKKLESEGIGRPSTYAPTISTLQARNYIEIEKRAIMPTEIAFTVTEMLENHFNEIVDAS
FT                   FTATMEETLDEISESGKSWHKILLDFYYPFIEKIDAGKSNIVSLKMAKPLGRNCPQCGS
FT                   ELLLRSGRFGEFIACSGFPKCKYTEQTEENQKENPATPDEVSEEVCDKCGSAMVVKNGR
FT                   NGKFLACSGYPKCKNTKTLNQETKFSQVPCPECGGKLLWRQSRRGAFWGCEHYPKCKFI
FT                   SKFEPSDKKCEVPGCGGALAPRTYRNKEVYECVKCKDRTPREEAGE"
     ttgaaactca tcattgtcga gtctccggcc aaagccaaga ccatcaaaaa ctttctctct        60
     aaagattacg aggtaattgc ctctaaaggt catattcgcg acctcccaaa aaaccgtttc       120
     ggtattaaaa tcgatgacga aaaaataatt gccgaatatc gcatcagtga agacagcacc       180
     gcgaccgtca aacagattca agaattggct aaaaaaagcg atacgatcta tatcgcgacc       240
     gatgaggacc gtgagggaga ggctatcgga tggcatattg cccatgctat tgataaagac       300
     ccctcatcgc ttccgcgtat cgtatttcat gagattacta aaaatgcgat tatccatgca       360
     ctcgaaacgc cgcgtacgat cgatatggat cgtgtcaatg cacagcaagc ccgccggtta       420
     ttggaccgga ttgtagggta taagctctct ccgcttttgg ctaataaaat ccaaaaaggg       480
     ttgtctgccg gacgggtaca atcctctacc cttaaaatcg ttgtcgatag agaaagagaa       540
     atccgtgctt tcattccgga agagtattgg acgatcgata cccttttcaa aaaagatatc       600
     gaagccgcac ttgtcaactt tgagaatgag aaaattgata aactcactat caaaacgggt       660
     gatgaggctg ctcggattgt tgagactctg aaaggtgaaa gttttaaagt cggcgagatt       720
     gagaccaaag agcgcaaaag ctctacaccg ccgccgttta tgacgtctac tttgcagcaa       780
     acggccagct cacagcttgg attttctccg aaaaagacga tgatggtggc tcaagcgctg       840
     tacgaggggg ttaaaactcc tgaggggacc agcggggtta tcacctacat gcgtaccgat       900
     tcactcaatc ttgcaaccga agcggttgag gcggcacgcg aagtgatttt gacccgttac       960
     ggcaaagagt atcttcccaa agaagcgaaa gtttatacga aaaaatccaa aggggcacaa      1020
     gaggcgcatg aagcgatccg cccgactatg cttggcttta ccccggaagt tgcggctacc      1080
     tatcttaaac ctgatgagat caaactttat cgtctcatct acaatcgctt tttggcatgt      1140
     cagatgaacg atgcacgctt tgaacagcaa agtattacgt ttgaatcggc aaaagcacag      1200
     tttcgagcga caggtcgaaa gcttttgttt gacggatttt accgtgtaac cggaagtgat      1260
     gacaaagaca aactcctccc gtcacttacg accggagatt cgatcgagat acaaaccgtt      1320
     acgcctgagc agcattttac cgagccgccg gcacgctatt cggaagcgag tctgattaaa      1380
     aagctcgagt ctgaagggat cggccgtcca tcgacgtatg caccgacgat aagcacgctt      1440
     caagcgcgta actacatcga gatcgaaaag cgtgcgatca tgccgactga gatcgctttt      1500
     accgttacgg agatgctgga gaatcatttt aatgagattg tcgatgcctc ttttaccgcg      1560
     actatggaag agacccttga tgagatcagt gagagcggca aatcgtggca caaaattttg      1620
     ctcgattttt actatccgtt catcgagaaa attgatgcgg gtaaaagcaa cattgttagt      1680
     ctcaaaatgg cgaaaccgct cggacgaaac tgtccgcagt gcggaagcga attgttgctc      1740
     cgctcgggcc gtttcggtga gtttattgcc tgcagcgggt ttccgaagtg taaatacacg      1800
     gagcagaccg aagagaatca aaaagagaat cccgcaaccc ctgatgaggt gagtgaagag      1860
     gtatgtgata aatgcggcag cgcgatggtg gttaaaaacg gccgtaacgg aaagtttttg      1920
     gcgtgcagcg gctatccgaa atgtaaaaat accaaaacgc tcaatcagga aacgaaattc      1980
     tcacaagttc cgtgtccgga atgcggcgga aagctactgt ggagacaatc gcggcgcggt      2040
     gcattttggg ggtgtgaaca ttatccgaaa tgtaaattta tctccaaatt tgaaccaagt      2100
     gataaaaaat gtgaagtccc gggatgcggc ggagcactgg caccgcgaac gtatcgcaat      2160
     aaagaagtgt atgagtgtgt taaatgtaaa gatcgtacgc ctcgcgagga agccggtgaa      2220
     tga                                                                    2223
//

If you have problems or comments...

PBIL Back to PBIL home page