(data stored in ACNUC7421 zone)

EMBL: CP002355.PE179

CP002355.PE179       Location/Qualifiers
FT   CDS_pept        185847..186695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0180"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="COGs: COG0502 Biotin synthase; InterPro IPR002684:
FT                   IPR007197: IPR010722: IPR006638; KEGG: tdn:Suden_0169
FT                   biotin synthase; PFAM: Radical SAM domain protein; biotin
FT                   and thiamin synthesis associated; PRIAM: Biotin synthase;
FT                   SMART: Elongator protein 3/MiaB/NifB; SPTR: Biotin
FT                   synthetase; TIGRFAM: biotin synthase; PFAM: Radical SAM
FT                   superfamily; Biotin and Thiamin Synthesis associated
FT                   domain; TIGRFAM: biotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32847"
FT                   /db_xref="GOA:E4TXF0"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF0"
FT                   /protein_id="ADR32847.1"
FT                   /translation="MKKIFLCSICNINSGTCNEDCKFCSQSVKYKADIERYRQKPMEQI
FT                   LEEARRLEALGALGFCLVTAQKGLDDKTLDFVCNVASTLKREVPRLRLIACNGTASFEQ
FT                   LNELRRAGVSAYNHNLETSREFYPQVCTTHPWDERYETCENVNRSGLKLISGGIFGMGE
FT                   TQEDRLSMLYSLKELNPISVPLNFYHHNAALPLNPSPLTIDESLELISLARKILDKADR
FT                   IMIAGGREITFKERQHEIFEAGANSIVIGNYLTTAGREAHADLMMLQDLGFEIAMTPED
FT                   K"
     atgaaaaaga tttttctttg ctccatctgt aatatcaaca gcggaacatg taacgaagat        60
     tgcaagtttt gcagccagag cgttaaatat aaagctgaca ttgagcgtta ccgtcaaaag       120
     cccatggagc agattttgga agaggcccga cgtcttgaag cactcggggc attaggcttt       180
     tgtctcgtga cggctcaaaa agggctggat gacaaaacgc tcgattttgt ttgcaacgtc       240
     gcttcgacac tcaaacgtga agttccccgc ttacgtctta tcgcctgcaa cggtacggcg       300
     tcgtttgaac aattgaacga attgagacgc gcgggtgtga gtgcctataa tcacaatctt       360
     gaaaccagcc gggagtttta tccacaggta tgtacgacgc atccgtggga tgagcggtat       420
     gagacgtgtg aaaatgttaa ccgttccggt ctaaagctga tcagtggggg gattttcggt       480
     atgggcgaaa cgcaggaaga tcgcctcagc atgctgtact ccctaaaaga gctcaaccct       540
     atatcggtcc cgcttaactt ttatcatcat aatgcggcat tgccgttaaa tccgagtcct       600
     cttacgattg atgagtcatt ggaactgatt tcacttgcac gaaaaatact ggataaagcg       660
     gatcgtataa tgatcgccgg aggacgggaa attacattta aagagcggca gcatgagata       720
     ttcgaagccg gtgccaacag tatcgttatc ggaaattatc tcacgactgc aggccgagag       780
     gcacatgccg atttgatgat gctacaagat ctcggttttg aaattgctat gacacctgag       840
     gataagtaa                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page