(data stored in ACNUC7421 zone)

EMBL: CP002355.PE18

CP002355.PE18        Location/Qualifiers
FT   CDS_pept        complement(18880..21708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0018"
FT                   /product="protein of unknown function DUF490"
FT                   /note="COGs: COG2911 conserved hypothetical protein;
FT                   InterPro IPR007452; KEGG: tdn:Suden_1135 hypothetical
FT                   protein; PFAM: protein of unknown function DUF490; SPTR:
FT                   Putative uncharacterized protein; PFAM: Family of unknown
FT                   function (DUF490)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32686"
FT                   /db_xref="GOA:E4TW70"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW70"
FT                   /protein_id="ADR32686.1"
FT                   /translation="MKRFWSLPWRKWFKHLFVTAHFLLYSSLLAASALLYIAFRPDGLE
FT                   IVNTYFLKPLGIRYTHAEGSLLDGFTLHNLRTDNARAKTFVLKYNLVKILEGEHTIDSV
FT                   QIDGLRLQLDDFKSDGTSIWPFPTFKLRDVTVTNLQLISSYSVELDLHGKNGTYDGDVI
FT                   NFSSLNATFKSRYASGAISGTVHQNSIRGMADIYPNSAELAPYSGRFTTLPRSLRIEIK
FT                   ELSNEKAILRTTIAALQSKQDPAVQAKAISLDFRYIYENDYLDIDALYTLIRGSDSMKT
FT                   KHHLRYALEGKTTTEFDGIITSNHPLPSNTLHGAFSDDTNGLSGTLTLDGSTLALASKD
FT                   YERFSWKLRSTHKNLRFIPSLPGALRSGSFELNGEGSYLLSSDSLKGTVDASHEDALFR
FT                   GIFSSRNGYRVLDGNLTLPGDAPLWKNWAHKPPEHLSISLNNEANATRLNLSGDALSFS
FT                   AVMQREKLKGSGNYLGTFFNVSGLLAPTQTRIDIDTFTPSVFATASELRPIELHKGEYY
FT                   DAEMRTKTRITLSDTLSIQSDIEIPWYAAVLDSQRAYGGTDGRVRLAYRDGNITVENYR
FT                   LEIANHPITTDKTSHLHINSAGGVTIDEFWIFDTLFLSGTVNSDLSAALRLHSDRFSYQ
FT                   GPERLAHASADMTFVRDAQANQTLSGVVNILDATITYLPFQEFKVMDDDIIIVQDVRPP
FT                   SSAKLSMNLRVTAAQPIRFKTKELDLRLDPDLTLWKEPTGPVQILGMITIPSGTAVSAG
FT                   KSFDIKHSEIYFGGDVPLNPYLNITIGHEVDYNKILIYVTHTLDSPIFLFSSDPVMSQN
FT                   DIMSYLLFGGPANTVSGGDSSTSTVRADATNFMLGAGLKGLINGATKLQIDTMNILTTA
FT                   EGGMGFEVGARLNKDLRVLYKNDTVSSVLIQYSLNRWLRLDADIHELGQGINAIYIKDF
FT                   RDFLPHNKPAKK"
     ttgaagcggt tttggtctct tccgtggcgc aagtggttca aacacctgtt cgtaacggcc        60
     cattttctcc tctacagttc actattagct gcttcggcac ttctctacat cgcttttcgt       120
     cctgacggac tcgaaatcgt caatacctat tttttaaagc cgctcggtat ccgttatacc       180
     catgcggagg ggtcgcttct ggatggattt acccttcata acctccgcac cgataacgcg       240
     agagctaaaa cgtttgttct aaaatacaac cttgtcaaaa tattggaagg ggagcatacg       300
     atcgattcgg ttcaaatcga cggattacgg ctacagcttg atgattttaa aagcgacggc       360
     acttcaatct ggccgtttcc gacatttaaa ctgcgcgacg ttacggttac caatctgcaa       420
     ttgatcagct cctattccgt agaactcgat ctgcatggga aaaacggaac gtatgacggg       480
     gatgtgatta atttttcttc gttgaacgca acttttaaat cccgttatgc cagcggagcg       540
     atcagcggaa ccgtacatca aaattcgatc aggggtatgg cagatatcta tccgaattca       600
     gctgagctag ctccttacag cggacgtttt acaacattgc cgagaagttt gcgtatcgag       660
     ataaaagaac tctcaaatga aaaagcgatt ttacgcacga caatcgctgc gttgcaatcc       720
     aaacaagacc ctgccgtgca agccaaagca atttccctcg atttccgata tatctatgaa       780
     aacgactatt tggatattga tgccctgtat accctgatac gcggcagtga ctctatgaag       840
     acaaaacacc atcttcggta tgcgttggaa gggaaaacga caaccgagtt tgacggcatt       900
     atcacctcaa atcatcccct cccctccaat acactgcacg gagcgttcag tgacgatacc       960
     aacggtcttt cgggcacgct taccctcgat ggaagtaccc ttgctctcgc ttcaaaagat      1020
     tatgaacgtt tcagctggaa gctcagaagt acccataaaa acctccgatt tatcccctca      1080
     ttgccgggcg cactccgctc aggctcattt gagcttaacg gtgagggatc gtatctgctc      1140
     agtagtgatt cgttaaaagg gacggtcgat gcgtcgcatg aggatgccct ctttagagga      1200
     attttttctt cccgaaacgg ctatcgcgta ttggacggaa atctcaccct ccccggagat      1260
     gcgccgctgt ggaaaaactg ggcgcataag cctccggaac atttgagcat ttcgttgaac      1320
     aatgaggcca atgccacacg gttgaatctt tcaggagatg ctctgagctt ttcagctgtc      1380
     atgcagaggg agaaactcaa aggttccggc aactatctgg ggactttttt taatgtaagc      1440
     ggcttattgg caccgaccca aacccgtatc gatatcgata ctttcacccc ctccgtgttt      1500
     gccaccgcct cggagcttcg tcccatcgaa ttgcacaagg gggaatatta cgatgcggaa      1560
     atgcgaacca aaacccgtat tacgctttcc gataccctca gtatccaaag cgatatcgag      1620
     ataccgtggt atgccgccgt acttgactcg cagcgcgcct acggagggac ggacggcagg      1680
     gttagattgg cgtatcgtga cgggaatata acggtcgaaa attaccgact ggaaattgcc      1740
     aaccatccga ttactaccga taaaacgtcg catctgcata tcaactccgc ggggggagtc      1800
     actatcgatg agttctggat atttgatacg ctgtttctaa gcggaacggt gaattcggat      1860
     ctgagcgctg ccctgcggct gcactcggat cgtttcagct atcaaggacc cgagaggttg      1920
     gctcatgcct ctgccgatat gacctttgtg cgtgatgcac aggcaaatca aactctgagc      1980
     ggggtagtga atattttgga cgcgaccatc acctatttgc cgtttcagga gttcaaagta      2040
     atggacgatg atatcatcat tgtccaagac gttcgccctc cgagcagtgc aaaactctcc      2100
     atgaatcttc gtgttacggc tgcacaaccg atccgtttca aaaccaaaga actcgatttg      2160
     cgtcttgatc ccgatctaac cctttggaaa gagccgacgg gtccggtaca gattttagga      2220
     atgatcacga ttccctccgg aacggcagtg agtgcgggca aatcgtttga tatcaagcat      2280
     tccgaaatct atttcggcgg tgatgttccc cttaacccgt atctcaacat tacgatcggg      2340
     catgaggtcg attacaacaa aatacttatc tacgtcaccc ataccctcga ttcgccgatt      2400
     ttcctcttca gctccgatcc ggtgatgagt caaaacgaca ttatgagcta tcttctcttc      2460
     ggcggaccgg ccaatacggt ttcaggcgga gacagctcca catcaaccgt tcgggccgat      2520
     gcgaccaatt ttatgctggg agccggactt aaagggttga tcaacggagc gacgaaactt      2580
     cagatcgata cgatgaacat tcttaccacc gccgaggggg ggatgggatt tgaagtgggc      2640
     gcgcgtctca ataaagactt gagagtcctt tacaaaaatg ataccgtctc cagcgtttta      2700
     atccaatatt cgcttaaccg gtggctgcgg ctggatgccg atattcatga actgggacag      2760
     gggatcaatg cgatttacat caaagacttc cgtgactttc tccctcataa caaaccggct      2820
     aaaaaataa                                                              2829
//

If you have problems or comments...

PBIL Back to PBIL home page