(data stored in ACNUC7421 zone)

EMBL: CP002355.PE180

CP002355.PE180       Location/Qualifiers
FT   CDS_pept        186737..187090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0181"
FT                   /product="AMMECR1 domain protein"
FT                   /note="InterPro IPR002733; KEGG: sdl:Sdel_0034 AMMECR1
FT                   domain protein; SPTR: Putative uncharacterized protein;
FT                   PFAM: AMMECR1"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32848"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF1"
FT                   /protein_id="ADR32848.1"
FT                   /translation="MSQSVLLTIARASIEEVLQGQNSINRRELLEQFPILSEPMATQIT
FT                   LYLGTKIRGSAKTQTAERSLLEDIIYNAKTAAFQDENFDPLVTSEYLHATIHLTIFSPE
FT                   GELSHQSDPILSE"
     atgtcgcaat ccgtattatt aaccattgct cgagcttcta tcgaagaggt cttgcaaggg        60
     cagaattcga ttaatcgacg tgaacttctc gaacaattcc cgatactatc cgaacctatg       120
     gcgacacaaa taacactcta tctcggcaca aaaattcggg ggagtgccaa aacgcaaacg       180
     gccgagcgtt cactccttga agacattatc tataatgcca aaacagccgc tttccaggat       240
     gaaaatttcg atccgctcgt cacctctgaa taccttcatg ccacgataca cctgactatt       300
     ttcagccctg agggcgaatt aagccatcag agcgacccta ttttatcaga gtaa             354
//

If you have problems or comments...

PBIL Back to PBIL home page