(data stored in ACNUC7421 zone)

EMBL: CP002355.PE182

CP002355.PE182       Location/Qualifiers
FT   CDS_pept        188124..188456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0183"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cmu:TC0253 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32850"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF3"
FT                   /protein_id="ADR32850.1"
FT                   /translation="MYYVIQRHHGDPKKHYLAYTVPRYISSENSQNIIFEFRHNDTVKR
FT                   KWAPKEEIVLLTDNEQFFKETLEKLESLKRTHLERIGAAETQLNQEISAMLSTMQTEFE
FT                   TIKKNN"
     atgtactatg taattcaacg acaccacggc gatcctaaaa aacattatct tgcgtacacg        60
     gtaccgcgat atattagttc tgagaactct cagaatatta tttttgagtt ccgccataat       120
     gacactgtta aacgaaaatg ggctccaaaa gaggagattg ttttgttgac tgacaacgag       180
     cagtttttta aagagacact tgaaaaactt gaaagtttaa agcgcactca tctcgaacgg       240
     ataggtgctg ccgaaacaca gctgaatcag gaaatttctg caatgctcag tacgatgcag       300
     acagaatttg aaaccattaa aaaaaacaat taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page