(data stored in ACNUC7421 zone)

EMBL: CP002355.PE183

CP002355.PE183       Location/Qualifiers
FT   CDS_pept        188533..189636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0184"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="COGs: COG2885 Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)protein; InterPro IPR006664:
FT                   IPR006665: IPR003367; KEGG: tdn:Suden_2018 OmpA/MotB; PFAM:
FT                   OmpA/MotB domain protein; Thrombospondin type 3
FT                   repeat-containing protein; SPTR: OmpA/MotB; PFAM: OmpA
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32851"
FT                   /db_xref="GOA:E4TXF4"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF4"
FT                   /protein_id="ADR32851.1"
FT                   /translation="MKKLLFSSLLAATLLNASDYNYEVTPVVGYLWNSTANENTQSNRG
FT                   AMGGVDNHALYGLEMQMNNACDLIKPELSLLYGRDRADGETDKTGVLTTMLNGVYEMPT
FT                   DTAITPFAKAGVGYEWYTNTHPNDFDGMLLDAGLGLKAEITDRIALKLEGLYMYKMNRN
FT                   GSADGSNGEVHNVAALAGLTFSFDKKAAPVAAVAAPAVAEAVAPAPKAEAKPVPAPAPK
FT                   AVAPIDSDGDGVIDSLDKCPGTPKGFKVDADGCPLKATLHLNFATDSTKVDAEGAAKVA
FT                   EFASFLKESPAYKANIVGHTDSTASDAYNQKLSEKRAAKVKSMLIEDGVDSSRLTSEGM
FT                   GEKMPIASNKTKEGRAENRRIEVELCK"
     atgaagaaat tactattttc aagtttgctt gctgcaacac tgctcaatgc aagtgattac        60
     aattatgaag tgactccggt tgtgggttac ctatggaaca gtacggcaaa tgagaacacg       120
     caatccaacc gcggtgcgat gggcggagtg gataatcatg cgctctacgg tcttgagatg       180
     cagatgaaca acgcatgcga tttaatcaag ccggaactgt ctcttctgta cggacgtgac       240
     cgtgcggatg gcgaaacgga taaaaccgga gtattgacca cgatgcttaa cggtgtttat       300
     gaaatgccga ccgatactgc gattacaccg tttgccaaag caggggttgg gtatgaatgg       360
     tatacgaata cccatccgaa tgattttgac ggaatgctct tggatgcagg tcttgggcta       420
     aaggctgaaa tcacagaccg tatcgccctt aaattagagg gtctttatat gtataaaatg       480
     aaccgtaacg gttctgcgga cggcagtaac ggcgaagttc ataatgtagc ggctcttgcg       540
     ggattgacat tcagctttga taaaaaagct gcacctgttg ctgccgttgc cgctccggcc       600
     gttgctgaag cggtcgcgcc tgctccaaaa gctgaagcaa aaccggttcc tgcaccagct       660
     ccaaaagctg tggcaccgat tgacagtgac ggagacgggg taatcgattc tttggataaa       720
     tgtccaggca cacctaaagg gtttaaagtt gatgcagacg gatgtccgtt gaaagcgaca       780
     cttcatttga attttgcaac ggactcaaca aaagttgatg cagaaggggc ggctaaagtc       840
     gctgaatttg caagcttctt aaaagaaagt ccggcctata aagctaatat tgtaggtcat       900
     acggacagca ccgcatctga tgcctataac caaaaacttt ctgaaaaacg tgctgcaaaa       960
     gtaaaatcga tgcttatcga agacggtgtt gactcttctc gtttgacttc tgaaggaatg      1020
     ggtgaaaaaa tgccgattgc ttcgaacaaa accaaagaag gacgtgcgga aaaccgccgt      1080
     attgaagtag agctttgtaa ataa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page