(data stored in ACNUC7421 zone)

EMBL: CP002355.PE186

CP002355.PE186       Location/Qualifiers
FT   CDS_pept        190573..191241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0187"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ttu:TERTU_2504 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32854"
FT                   /db_xref="InterPro:IPR026387"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF7"
FT                   /protein_id="ADR32854.1"
FT                   /translation="MFRASILVLCLVSVSASAATILGFGAEADYYTPSASGDFDYKNTH
FT                   TRFGNNDESGYQIGLFVEHPVPVIPNVRIDFTPKTSFSGSDGIGGSSKVSVTQTDITPY
FT                   YEILDNAVEIDFGVSFKVLDATVEGTINESLNEVIPMGYLGVALTPPYSPIGMEGSVKY
FT                   VGYNGDSLTDARIKLVWKIGAGLGAQAGYRYESLKVSDHFDLNSDVTFKGPFVGFNYRF
FT                   "
     atgtttagag catctatttt agtgttatgt ttggtatcgg ttagcgcatc tgcggcaact        60
     attttaggat tcggtgcaga ggcagattat tatacaccga gcgcaagcgg ggattttgat       120
     tataaaaata cccatacccg ttttggaaat aatgacgagt caggctacca gataggactg       180
     tttgtagaac atccagttcc tgtaatccct aatgttcgca tagattttac acctaaaacg       240
     agttttagcg gttcagacgg gatcggcggc agtagcaaag tttcagtgac tcagacggat       300
     attaccccgt attatgagat tcttgacaat gcagtcgaga ttgattttgg ggtcagtttc       360
     aaagtgttag atgctacggt cgaaggtact attaatgaga gtctgaatga agttataccg       420
     atgggatatc tgggggttgc actaactccg ccgtattctc cgatagggat ggaagggagt       480
     gtaaaatatg tcggatataa cggggattct ttaacggatg cacgaattaa gctggtttgg       540
     aagataggag cagggttagg cgctcaggcg ggataccgct acgaatcgct taaagtttcg       600
     gatcattttg atttgaacag tgacgttact tttaaaggac cgtttgtcgg atttaattac       660
     cgtttctaa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page