(data stored in ACNUC7421 zone)

EMBL: CP002355.PE187

CP002355.PE187       Location/Qualifiers
FT   CDS_pept        complement(191238..192305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0188"
FT                   /product="uncharacterized ATPase"
FT                   /note="InterPro IPR021115; KEGG: tdn:Suden_0284
FT                   uncharacterized ATPase; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32855"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF8"
FT                   /protein_id="ADR32855.1"
FT                   /translation="MNTLLDEYYRYDLHNAGFIERKYTIGDENTLIYGITQSGKTSLIK
FT                   NHLLSYKKSTYLYLDCRDVRLDTNDLNRSLKNFCRENKISILALDNYNEEIELFDMDQI
FT                   ILSSDKMLPIPFHTVQLELLDYEEFLAFETKFDSTALNHFFQLGGFPAMHRIPSEERVL
FT                   YLQNTLKNTLEPIEFSILAQASKMVTQKVSAFNLYERLKGERKISKDKLYLHLQSMYDR
FT                   GYLKSLEKFNHPSAVKKLYLCDIAIKHALVTQKHFGRLFENLVFSELDKHHIECYYDEG
FT                   IDFYLPHRRQIIIASPFANEHALFKKVEALEAFIVSNRIREVIVVTMNLESTLSHPVSR
FT                   IEMIPFEMWALGDDA"
     atgaacactt tattagatga gtactatcgc tacgatttgc ataacgccgg atttatagaa        60
     cgtaaatata cgatcggcga tgaaaatacc ctgatttatg gaattacaca gtcaggcaaa       120
     acgtctttga tcaaaaatca tctcctgtcg tataagaaat cgacctatct gtatctcgat       180
     tgccgagatg tacgactcga cacaaatgat ctcaaccgat cactgaaaaa cttttgccga       240
     gaaaataaaa tttctatcct tgccctcgat aactataatg aggagataga gctgtttgat       300
     atggatcaaa tcatcctctc atccgacaaa atgctcccga ttccctttca tacagtgcag       360
     cttgaactac tcgattacga ggaatttctt gcttttgaaa ccaaatttga ttcgacggca       420
     ctcaaccatt tttttcaact cggcggtttt cccgctatgc accgcattcc cagcgaagag       480
     agagtcttgt atctgcaaaa caccctcaaa aacacgttgg agcccatcga gttctctatt       540
     cttgcgcaag cttccaaaat ggtgacgcag aaagtttccg cattcaatct gtacgaacgg       600
     ctcaaagggg agcgcaaaat atccaaagac aaactttatc tccatctgca gtcgatgtat       660
     gatagaggtt atctaaaaag tttggagaag ttcaatcatc cgagcgccgt caaaaaactc       720
     tacctgtgtg atatcgccat taaacatgcc ctcgtaactc aaaaacattt cggacgactt       780
     tttgaaaatc ttgttttctc ggaactggat aaacatcata tcgaatgcta ttatgacgag       840
     gggatagatt tttaccttcc tcatagacgg caaatcatta tcgcttcacc gtttgcgaat       900
     gaacatgcat tatttaaaaa agtagaagcg ctggaagctt ttatcgtatc gaaccgcata       960
     cgagaagtaa ttgtagtaac tatgaattta gaaagtaccc tctctcaccc ggtatcacgt      1020
     attgagatga tcccgtttga aatgtgggca ttgggagatg acgcttag                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page