(data stored in ACNUC7421 zone)

EMBL: CP002355.PE188

CP002355.PE188       Location/Qualifiers
FT   CDS_pept        192479..192790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0189"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="COGs: COG0051 Ribosomal protein S10; InterPro
FT                   IPR018268: IPR005731: IPR001848; KEGG: tdn:Suden_0285 30S
FT                   ribosomal protein S10; PFAM: ribosomal protein S10; SPTR:
FT                   30S ribosomal protein S10; TIGRFAM: ribosomal protein S10;
FT                   PFAM: Ribosomal protein S10p/S20e; TIGRFAM: ribosomal
FT                   protein S10, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32856"
FT                   /db_xref="GOA:E4TXF9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXF9"
FT                   /protein_id="ADR32856.1"
FT                   /translation="MEKIRLKLRAYDHRVLDRSVASIVEAVKRTGAEIRGPIPLPTKIR
FT                   KYTVLKSPHVNKDSREQFEIRMHARLIDIVSATPDTVDSLMKLDLAPEVDVEVRSMDK"
     atggaaaaaa ttcgtttgaa acttagagca tacgatcatc gtgtacttga tcgttcagtt        60
     gcctctattg ttgaagctgt aaagcgaacg ggtgcggaaa tccgcggtcc gatccctttg       120
     ccaaccaaga ttcgcaagta tacggttctt aaatctccgc acgtcaataa agactctcgt       180
     gagcaatttg agattcgaat gcatgcacgt ttgatcgaca tcgtgtcggc tacgccagat       240
     acagttgatt cgttgatgaa gcttgacttg gctccggaag tggacgtaga agttcgctct       300
     atggacaagt aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page