(data stored in ACNUC7421 zone)

EMBL: CP002355.PE19

CP002355.PE19        Location/Qualifiers
FT   CDS_pept        complement(21705..23399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0019"
FT                   /product="surface antigen (D15)"
FT                   /note="COGs: COG0729 Outer membrane protein; InterPro
FT                   IPR010827: IPR000184; KEGG: tdn:Suden_1136 surface antigen
FT                   (D15); PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat-containing protein; SPTR: Surface
FT                   antigen (D15); PFAM: Surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32687"
FT                   /db_xref="GOA:E4TW71"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW71"
FT                   /protein_id="ADR32687.1"
FT                   /translation="MRYGIVIALFCTALMSTPLPITFSGNEKISSDKLFGVLGLRKPYG
FT                   IEVWEDQPSIEPIAISQSVSALSSFYKSKGFYHARVTSETNENGVLFKIQENDPILVGT
FT                   VQINSPLDIKSAVSLHTDELFDQEEFSESKSLIKKRYGEAGYCNAQFNTKAWVDIETNR
FT                   AYLLFEATPGEACTFGKVSVESTSNIDGNLTASMLRFNEGDPYSVEAIKLSYEALYAQE
FT                   GISRVIINDNERNGSVVPISLNIEEAERPIRFTAGFGYSSDQGFAAQTGLKHRNFFGDL
FT                   KTLGLDFRYSQIKQEAAGSFGLPLQNRGLLGVDVGYKNEIFDGYKTESTYQKLTAKYQD
FT                   TPASAMMGFLFDQVKTYDSKDIATFPDNKLSLISPIGELNYDTRDKPLEPTKGYWLNAN
FT                   FMGSLYTPQLSDASYFKTLLSAAYITSIDEHVFGAKLKWGTLHVYDGAVPSSYRFYAGG
FT                   MNSNRAYTYRDLGPKNFDGDPIGFSSLTEGAFEYRFPIYQEFRGVLFTDVTFASQNTVP
FT                   DYAKDGYLGVGAGFRYVTPIGPVAIDFGFDPEDTSQYAIHFRIGELF"
     atgcggtacg gtatcgttat agcgttgttc tgtactgcat tgatgagtac cccccttcca        60
     atcacgttca gcggcaatga gaaaatttct tccgataaac ttttcggcgt tttaggattg       120
     cgtaaaccct acggcatcga ggtgtgggaa gatcagccct ccatcgagcc gatcgcaatc       180
     tctcaaagcg tttcggcgtt gagcagtttt tataaatcaa aaggatttta tcacgcccgc       240
     gtgacgtcgg agacgaatga gaacggcgtt ctcttcaaaa ttcaggagaa tgatccaatc       300
     ctcgtcggca ctgtccagat caacagtccg ttggatataa aatcggctgt ttcgcttcat       360
     accgatgagc tgtttgatca ggaggaattt tccgagtcaa aatcgttgat aaaaaaacgc       420
     tacggtgaag cgggctattg caatgcgcag ttcaatacca aagcctgggt cgacatcgaa       480
     acaaaccgtg cctatctact gttcgaagct acgccggggg aggcgtgtac gttcgggaaa       540
     gtcagtgtcg aatcgacttc caatatcgac ggaaatctca ccgcttcgat gttacggttt       600
     aacgagggag acccgtacag tgtcgaagcg atcaaactca gctatgaagc attgtatgcc       660
     caagagggga tcagccgcgt tatcatcaac gacaatgagc gtaacggtag tgttgttccg       720
     atctctctca atattgaaga agcggaacgt ccgatccgtt ttaccgccgg tttcggatac       780
     agcagcgacc agggatttgc ggcacaaaca ggactcaaac accgcaattt tttcggtgat       840
     cttaaaactc tcggattgga ttttcgctat tcgcagatca agcaggaagc tgccggatcg       900
     ttcggacttc cgcttcaaaa ccgggggctt ttgggggtag atgtcggata taaaaatgag       960
     atatttgacg ggtataagac ggagagtacc taccaaaaac tgacggcgaa gtaccaagac      1020
     acccccgcat cggcgatgat gggattttta ttcgatcagg taaaaacata tgacagtaaa      1080
     gacatagcaa cgtttcccga caataaactc tccctcattt cgccgatcgg ggagcttaac      1140
     tacgatacgc gggataagcc gcttgaaccg accaaagggt attggctcaa tgccaacttt      1200
     atgggttcgc tctacacgcc gcagttatcg gacgccagtt atttcaaaac cctcctctcc      1260
     gccgcctaca tcacgagtat cgacgagcat gttttcggtg ccaaactcaa atgggggacg      1320
     ttacacgtat acgacggggc ggttccctca tcgtaccgat tttatgccgg ggggatgaac      1380
     tccaaccgtg cctacaccta tcgtgacttg ggtcctaaaa acttcgacgg cgatccgatc      1440
     gggttttctt ctttgaccga aggagcgttt gaataccgct tccccatcta tcaggagttt      1500
     cgcggagtgc tgtttaccga cgtgacgttc gcctcccaaa atactgttcc cgattatgcc      1560
     aaagacggtt atcttggggt aggggcagga tttcgttatg tcactccgat cggtccggtt      1620
     gcgatcgatt tcggatttga cccggaagat acatcccaat acgccatcca ttttcgaatc      1680
     ggagagttgt tttga                                                       1695
//

If you have problems or comments...

PBIL Back to PBIL home page