(data stored in ACNUC7421 zone)

EMBL: CP002355.PE190

CP002355.PE190       Location/Qualifiers
FT   CDS_pept        193376..193987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0191"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="COGs: COG0088 Ribosomal protein L4; InterPro
FT                   IPR002136; KEGG: tdn:Suden_0287 50S ribosomal protein L4;
FT                   PFAM: ribosomal protein L4/L1e; SPTR: 50S ribosomal protein
FT                   L4; PFAM: Ribosomal protein L4/L1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32858"
FT                   /db_xref="GOA:E4TXG1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG1"
FT                   /protein_id="ADR32858.1"
FT                   /translation="MSAIVLNEKFEKASEAALPESFSGINPHNLYLYVKSYQASIRANT
FT                   ASAKTRSMISGGGKKPWAQKGKGGARAGSRRSPIFVGGAIAHGPNTGRNYDQKINKKQK
FT                   KLALKCALDALAQAGKLFIVDTIEVPSGKTKDAKVLFDKLNVRDALLVKKILDENTYLA
FT                   FRNISSTYVVEENELNAFLAATYRSVVIEKAVWENLTKES"
     atgagcgcga ttgtactgaa cgaaaaattc gaaaaagcct cagaagcagc attgccagag        60
     agctttagcg gtatcaaccc acataacctc tacttgtacg ttaaatcgta tcaagcgagt       120
     atccgtgcta atacggcatc ggctaaaact cgatcaatga ttagcggtgg tggtaaaaaa       180
     ccatgggctc aaaaaggtaa aggtggcgca cgtgctggtt cacgccgttc acctatcttt       240
     gttggcggtg cgattgcaca cgggccgaac actggtcgta actacgatca aaaaatcaat       300
     aaaaagcaaa agaaactagc gcttaaatgt gcgttggatg ctttggctca agctgggaaa       360
     ttgttcatcg ttgatacgat cgaagttcca agcggtaaaa caaaagatgc aaaagtattg       420
     tttgacaaat tgaacgtacg tgacgcattg ttggtgaaaa agattctcga tgagaatacc       480
     tatcttgcat tccgcaacat ttcttctacg tatgttgtag aagagaatga actcaacgcc       540
     tttttggctg cgacataccg ttcggtggtt atcgaaaaag cggtatggga aaatctgact       600
     aaagagagct aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page