(data stored in ACNUC7421 zone)

EMBL: CP002355.PE191

CP002355.PE191       Location/Qualifiers
FT   CDS_pept        193989..194270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0192"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="COGs: COG0089 Ribosomal protein L23; InterPro
FT                   IPR013025; KEGG: tdn:Suden_0288 50S ribosomal protein L23;
FT                   PFAM: Ribosomal protein L25/L23; SPTR: Ribosomal protein
FT                   L23; PFAM: Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32859"
FT                   /db_xref="GOA:E4TXG2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG2"
FT                   /protein_id="ADR32859.1"
FT                   /translation="MADITDIKSILYTEKTLGLQEEGVIVVQTSPRMTKNALKEVFREY
FT                   FGIVPARVNSLNQDGKVKRFRGLAGKQNDFKKFYVKLPEGAQIDSLAV"
     atggcagata ttactgatat caaatcaatc ctgtatacag agaagactct tggtcttcaa        60
     gaagagggtg taatcgttgt tcaaacgtct ccacgtatga caaagaacgc tcttaaagag       120
     gtgtttagag agtatttcgg aatcgttccg gctcgcgtaa actcactaaa tcaagacgga       180
     aaagtaaaac gtttccgtgg tcttgctggt aaacaaaacg actttaaaaa gttctatgtg       240
     aaattgccag aaggcgcaca aatcgatagt ttggcggtgt aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page