(data stored in ACNUC7421 zone)

EMBL: CP002355.PE192

CP002355.PE192       Location/Qualifiers
FT   CDS_pept        194272..195117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0193"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="COGs: COG0090 Ribosomal protein L2; InterPro
FT                   IPR002171: IPR005880; KEGG: tdn:Suden_0289 50S ribosomal
FT                   protein L2; PFAM: ribosomal protein L2; SPTR: 50S ribosomal
FT                   protein L2; TIGRFAM: ribosomal protein L2; PFAM: Ribosomal
FT                   Proteins L2, RNA binding domain; Ribosomal Proteins L2,
FT                   C-terminal domain; TIGRFAM: ribosomal protein L2,
FT                   bacterial/organellar"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32860"
FT                   /db_xref="GOA:E4TXG3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG3"
FT                   /protein_id="ADR32860.1"
FT                   /translation="MAIKTYKPTTPSRRFYTNVDNSDITAKASVRSLLIKLPAAAGRNN
FT                   NGRITSRHKEAGAKKLYRIIDFKRNKFGVNGTVAAIEYDPYRNCRIALINYVDGDKRYI
FT                   LQPKGLVVGDVVAAAESGLDIKAGNAMKLMNIPVGTTVHNIELKPGKGGQIVRSAGTSA
FT                   QIMGREGKYVSLRLPSSEMRYVLGECMATVGTVGNEEYINIVLGKAGRTRHMGIRPQTR
FT                   GSAMNPIDHPHGGGEGKTNSGRHPVTPWGKPTKGAKTRKKKASDKLIITRRKPNAKRVG
FT                   "
     atggcgatca aaacctataa acctacaacc ccgagccgac gtttctatac taacgttgac        60
     aactcggata tcacggcaaa agcgtctgtt cgttcattgt tgatcaaact tccggcagct       120
     gctgggcgta acaacaacgg tcgtatcaca tcacgtcata aagaagcggg agctaaaaag       180
     ctttaccgta tcatcgattt caaacgtaac aagttcggtg taaacggaac tgttgcagca       240
     atcgaatacg atccgtaccg taactgccgt atcgctctta tcaactatgt agacggtgac       300
     aaacgttaca tcctccaacc aaaaggtttg gtagtcggtg atgttgttgc tgctgctgag       360
     agcggtttgg acattaaagc gggtaacgcg atgaaattga tgaacatccc tgtggggaca       420
     accgttcaca atatcgaact taaaccgggc aaaggtggac aaatcgtccg ttcagccgga       480
     acatctgcgc aaatcatggg tcgtgagggg aaatacgttt ctcttcgtct tccgtcaagt       540
     gaaatgcgtt atgtattggg tgaatgtatg gcgactgtcg gtactgtcgg taacgaagag       600
     tacatcaaca tcgtccttgg taaagcaggt cgtactcgtc atatgggtat ccgtcctcaa       660
     acgcgtggtt ctgcgatgaa ccctatcgat cacccgcatg gtggtggtga aggtaaaacg       720
     aattcaggac gtcacccggt tactccgtgg ggtaaaccga ctaaaggtgc taaaacacgt       780
     aagaagaaag caagtgataa attgattatt actcgccgta aaccaaatgc taaaagggta       840
     ggctaa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page