(data stored in ACNUC7421 zone)

EMBL: CP002355.PE194

CP002355.PE194       Location/Qualifiers
FT   CDS_pept        195411..195728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0195"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="COGs: COG0091 Ribosomal protein L22; InterPro
FT                   IPR005727: IPR001063; KEGG: tdn:Suden_0291 50S ribosomal
FT                   protein L22; PFAM: ribosomal protein L22/L17; SPTR: 50S
FT                   ribosomal protein L22; TIGRFAM: ribosomal protein L22;
FT                   PFAM: Ribosomal protein L22p/L17e; TIGRFAM: ribosomal
FT                   protein L22, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32862"
FT                   /db_xref="GOA:E4TXG5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG5"
FT                   /protein_id="ADR32862.1"
FT                   /translation="MARALLKFVRVSPTKSRLIAREVQGMNAEQAMAALEFTPNKAAKI
FT                   IAKVVASAVANSGIDAQDCVIKSCRVDNGPVLKRFTQRARGTASGIRKPTAHILVEVEG
FT                   K"
     atggcaagag cactattaaa attcgttcgc gtatctccga ctaaatctcg tttgatcgct        60
     cgcgaagttc aaggtatgaa tgcagagcaa gcaatggctg cattggagtt cactccaaac       120
     aaagcggcaa aaattatcgc taaagtggtt gcgtcagcag tagctaacag cggtattgat       180
     gcacaagatt gtgttattaa atcatgccgt gtagataacg gtcctgtact taaacgtttc       240
     actcaacgtg cacgtggtac ggcttctggt atccgtaaac cgacagcaca cattttggta       300
     gaagtagagg gtaaataa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page