(data stored in ACNUC7421 zone)

EMBL: CP002355.PE196

CP002355.PE196       Location/Qualifiers
FT   CDS_pept        196444..196869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0197"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="COGs: COG0197 Ribosomal protein L16/L10E; InterPro
FT                   IPR020798: IPR000114: IPR016180; KEGG: tdn:Suden_0293 50S
FT                   ribosomal protein L16; PFAM: Ribosomal protein L10e/L16;
FT                   SPTR: 50S ribosomal protein L16; TIGRFAM: ribosomal protein
FT                   L16; PFAM: Ribosomal protein L16p/L10e; TIGRFAM: ribosomal
FT                   protein L16, bacterial/organelle"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32864"
FT                   /db_xref="GOA:E4TXG7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG7"
FT                   /protein_id="ADR32864.1"
FT                   /translation="MLMPKRTKYRKMMKGRNRGYATNANKLDFGSIGFKATEAGRINSR
FT                   QIEAARIAANRHIKRQGKIWIRVFPAKPLTAKPLEVRMGKGKGSVDQWVMNIKPGRIIF
FT                   EMGGVEETLAREALSLAMQKLPFKTKIVTAEMSNEIY"
     atgttgatgc ctaaacgtac gaaatatcgt aaaatgatga aagggcgtaa ccgcggttac        60
     gctacgaatg ccaacaaact tgatttcggt tcaatcggat tcaaggcaac ggaagcggga       120
     cgtatcaact ctcgccaaat cgaagcggct cgtattgcag caaaccgtca tatcaaacgt       180
     caaggtaaaa tctggatccg tgtgttcccg gctaaaccat tgactgccaa accacttgaa       240
     gtgcgtatgg gtaaaggtaa aggttctgtt gaccaatggg taatgaacat caaaccaggc       300
     cgtatcattt ttgaaatggg tggtgttgaa gagactcttg cgcgtgaagc attatcgctt       360
     gcgatgcaaa aacttccgtt caaaaccaaa attgtaactg cggagatgag caatgaaata       420
     tactga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page