(data stored in ACNUC7421 zone)

EMBL: CP002355.PE197

CP002355.PE197       Location/Qualifiers
FT   CDS_pept        196856..197041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0198"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="InterPro IPR018254: IPR001854; KEGG: tdn:Suden_0294
FT                   50S ribosomal protein L29; PFAM: ribosomal protein L29;
FT                   SPTR: Ribosomal protein L29; TIGRFAM: ribosomal protein
FT                   L29; PFAM: Ribosomal L29 protein; TIGRFAM: ribosomal
FT                   protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32865"
FT                   /db_xref="GOA:E4TXG8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXG8"
FT                   /protein_id="ADR32865.1"
FT                   /translation="MKYTDLNGKTAAELQGMLKEKKIELFTLKIKQKMMQLTNTSELRT
FT                   AKKDIARINTAMNAVK"
     atgaaatata ctgatttgaa cggcaaaaca gctgctgaac ttcaagggat gctcaaagag        60
     aaaaagattg agcttttcac tttgaaaatt aagcaaaaaa tgatgcaatt gactaacacg       120
     agcgaacttc gcacggcaaa gaaagacatt gcacgcatta acactgctat gaacgcagtg       180
     aagtaa                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page