(data stored in ACNUC7421 zone)

EMBL: CP002355.PE198

CP002355.PE198       Location/Qualifiers
FT   CDS_pept        197052..197303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0199"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="COGs: COG0186 Ribosomal protein S17; InterPro
FT                   IPR019979: IPR019984: IPR000266; KEGG: abu:Abu_0761 30S
FT                   ribosomal protein S17; PFAM: ribosomal protein S17; SPTR:
FT                   30S ribosomal protein S17; TIGRFAM: 30S ribosomal protein
FT                   S17; PFAM: Ribosomal protein S17; TIGRFAM: 30S ribosomal
FT                   protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32866"
FT                   /db_xref="GOA:E4TXV3"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXV3"
FT                   /protein_id="ADR32866.1"
FT                   /translation="MTHKREIQGIVVTKAGEKTATIVVERRVMHPRYHKTVKRFKKYMI
FT                   HDENNQLNIGDEVIAIECRPLSKSKSFRLKTLVKGVNA"
     atgacacata aacgtgaaat tcaaggtatc gtagtgacta aggccggcga aaaaacagca        60
     actatcgttg ttgagcgccg tgttatgcat ccgcgttacc acaaaacggt aaaacgtttc       120
     aaaaaatata tgattcatga cgaaaacaac caacttaaca ttggtgatga agtgatcgcg       180
     atcgagtgcc gcccactttc aaaaagcaaa tcgtttcgtc ttaaaactct tgttaaagga       240
     gtgaatgcat ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page